(data stored in ACNUC30630 zone)

EMBL: AE000513.PE371

AE000513.PE371       Location/Qualifiers
FT   CDS_pept        complement(384279..384674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0385"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09968"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXD0"
FT                   /protein_id="AAF09968.1"
FT                   /translation="MEWVTPPLSSAAWPAALNAVLEALCGLGVESAELMHGWSFSDFSD
FT                   TPEFAAMEWQTEEVTLAALPELLRERARLGFCLGRDDLFLTLIGGAELKLCHEGDLHLR
FT                   AEDESFAVHLAGCLAKQGISLTRRAGA"
     atggagtggg tcacgccgcc gctgagctcc gccgcgtggc ccgctgccct gaacgccgtg        60
     ctggaggcgt tgtgcgggct aggcgtggag agtgccgagc tgatgcacgg ctggagcttc       120
     tccgacttct ctgacacgcc ggaatttgcg gcgatggaat ggcagaccga ggaagtcacg       180
     ctcgctgccc tgcccgaact gctgcgggaa cgcgcccggc tgggcttttg cctgggccgg       240
     gacgacctgt ttctgacgct gatcggcggc gcggaactca agctgtgcca cgaaggcgac       300
     ctgcatctac gcgcggagga tgaatcattc gcggtgcatc tggcgggctg tttggcgaag       360
     cagggcatca gcctgactcg ccgcgctggt gcctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page