(data stored in ACNUC30630 zone)

EMBL: AE000513.PE38

AE000513.PE38        Location/Qualifiers
FT   CDS_pept        38823..39977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000657 percent identity: 63.75;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09630"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYB1"
FT                   /protein_id="AAF09630.1"
FT                   /translation="MLGGGTGLECPRMTPDASLSPQLPELAQLSPSQLTLRLTRLGLQA
FT                   PDLGSAMQPMLEALVVCTGAAGAGYFQWRDATLAYHARAAAGEMPAGPAMEAILAHGLP
FT                   GHLPLIGALSTAEDTLFIGDTRQEAVALGFPELGVLGLCAAPIRARDGELVGAILAHTF
FT                   TPSPWPEPDRVLIGNVTGTLSLLAARLHAEEREQAAHEGALRALGLSLEARDAETKGHT
FT                   DRVTRLAERLGERLGLDFDERRELRWGAYLHDLGKISLPDEILLYEGPLTAALRRQMQG
FT                   HVQEGVRLAGQLPFLPQSVLDVIGAHHERWDGAGYPLGLRGEEIPLPARIFAICDVYDA
FT                   LSSARPYKKAWERADTLAYLRAVSGEQFDPQVVTALLDLLDGEG"
     gtgcttggcg gcggcactgg cctagaatgc ccgcgcatga ctccagacgc ttccctctcg        60
     ccgcagcttc cggagctggc ccagctttct ccctcacagt tgacgctgcg cctgacccgg       120
     ctggggttgc aggccccgga cctcggcagt gccatgcagc cgatgctcga agcgctcgtg       180
     gtgtgtacgg gcgcggcagg cgccgggtac tttcagtggc gggacgcgac gctggcctac       240
     cacgcccgcg ccgccgccgg ggaaatgccc gccggcccgg cgatggaggc gattctggca       300
     cacgggctgc cgggccacct gccgctgatc ggggcactct ccaccgccga ggacacgctg       360
     tttatcggtg acacccggca ggaggccgtc gcgctcggct ttcccgaact cggcgtgctg       420
     gggctgtgcg ccgcgccgat ccgggcccgc gacggcgagc tggtcggcgc gattctggcg       480
     cacaccttta cgccctcgcc ctggccggag ccggaccgcg tgctgatcgg caacgtgacg       540
     ggcaccctgt cgttgctggc cgcccggctg cacgccgagg aacgcgagca ggccgcgcac       600
     gagggcgctc tgcgggcgct ggggctgtcg ctggaagcgc gcgacgccga aaccaagggc       660
     cacaccgacc gggtcacgcg cctggccgag cggctgggtg agcggctggg cctggacttc       720
     gacgagcggc gcgaactgcg ctggggcgcc tacctgcacg acctcggcaa gatcagcctg       780
     cccgacgaga tcctgctcta cgaaggcccg ctgaccgccg cgctgcgccg gcagatgcag       840
     gggcacgtgc aggagggggt gcgcctcgcc gggcagcttc cctttttgcc gcagtcggtg       900
     ctcgacgtga tcggcgctca ccacgaacgt tgggacggcg ccgggtatcc gctgggtctg       960
     cgcggcgagg agattccgct gccggcccgc atcttcgcca tctgcgatgt gtacgacgcc      1020
     ctgagcagcg cccgcccgta caagaaggcc tgggaacgtg ccgataccct cgcctacctg      1080
     cgggccgtga gtggggagca gttcgaccca caggtggtga cggcactgct cgacctgctg      1140
     gacggtgagg ggtaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page