(data stored in ACNUC30630 zone)

EMBL: AE000513.PE386

AE000513.PE386       Location/Qualifiers
FT   CDS_pept        complement(401573..404515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0400"
FT                   /product="cell division protein FtsK, putative"
FT                   /note="similar to SP:P46889 PID:1004225 GB:U00096
FT                   PID:1651412 PID:1651418 percent identity: 56.73; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09980"
FT                   /db_xref="GOA:Q9RXB5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RXB5"
FT                   /protein_id="AAF09980.1"
FT                   /translation="MRRLQREIRTYDEEQLKQVREELTTYDLMTRNALLQTAHDLRAKV
FT                   EQEAVPEGEQATTYLKAVVDDRRHELSVFLPATQASAALENVRRHLVNQILSIGGKAKK
FT                   LETERCAAERHLKRPTVEVVQREHDAHLRRLRQWQEVQSRFQTWHTYEQAYARWPDLAA
FT                   AFDSGPTEAATRVATELHKRTLATMQEQDRWREFLRQATEQEHQRQLTPPEDDLPEDDL
FT                   EEDTWAAAESSEPSGSLFSRLGHTLSRLMAPPGPDEVPSAATAPRETDGWDDVQPQIAP
FT                   DPRSTVPGLWDDADDLTPVSPVAPARPAPSPPVYDAAAVPALDIDFSAAPRRSRTPAEQ
FT                   MPDPFARAARVRSARRTTTPLVPVPQQLDAAEMPAPRPARTPPGRPATAGNVAPPSAPR
FT                   TARPPSPTLADFDLWDDEEDMPFGPPATPAPAAASVPQMVPTPRAAARPTPRPVSSPGP
FT                   SPVPVSPASASVSHAAPWEEPAAGRPAPAPSGVSRRGATRLALPSEQLLDPLPNGARNT
FT                   VQMDLDAERRGDMINETLRQFGLQAKVVDLARGPTVTRYEIEPAPGEKISRIASLSNDL
FT                   ARALAVGGVRVEAPVPGKSVIGLEVPNAEREPVTFHQATANPAFKNTRAKLPIILGKSI
FT                   DGSMMVGDLAKMPHLLVAGSTGSGKSVCVNTLITSLLYRYLPTELRFVMIDPKMVELTP
FT                   YDGIPHLVRPVVTNPADAAGVLLGAVAHMERRYKMMSQVGAKNLEQFNAKMRAVGEVEL
FT                   PHLVIIIDELADLMITSPKEVESAIMRLAQMARATGMHLILATQRPSVDILTSLIKVNI
FT                   PARIAFAVSSSHDSRTILDTTGAERLTGMGDMLFYQPGLVKPLRLQGPYISEAESARIT
FT                   DELRRMMFDDDFIEAYGADFEGMISSSGPGGDRSQLDFSDPLLRQAALVCIEEGQGSVS
FT                   RLQRRLSVGHARAGKLMDLLEAMNIVGPHQGSKPREVLIHEADLPEYFGK"
     gtgcggcgcc tgcaacgcga aatcagaacc tacgatgagg agcagctcaa gcaggtgcgc        60
     gaggagctga ccacctacga cctgatgacg cgcaacgccc tgctgcaaac ggcccacgac       120
     ctgcgcgcca aggtggagca ggaggcggtg cccgaaggcg agcaggcgac cacctatctc       180
     aaggccgtgg tggacgaccg ccgccacgag ctgagcgtct ttttgcccgc cacccaggca       240
     agcgcggccc tcgaaaatgt acgccggcac ctcgtcaacc agattctgtc tatcggcggc       300
     aaggccaaga agctggaaac cgagcgctgc gccgccgagc gccacctcaa gcggcccacc       360
     gtggaagtcg tgcagcgcga gcacgacgcc cacctgcgcc ggctgcggca gtggcaggag       420
     gtgcaaagcc gcttccagac gtggcacacc tacgagcagg cgtatgcgcg ctggcccgac       480
     ctcgccgccg cgttcgacag cggccccact gaggcggcca cccgcgtggc gaccgagctc       540
     cacaagcgca ccctcgcaac catgcaggaa caggaccggt ggcgcgagtt tctgcgtcag       600
     gccaccgagc aggagcacca gcgccagctc acgcccccgg aggacgacct gccggaagac       660
     gacctggaag aggacacctg ggcggcagct gagagcagcg aaccgtccgg cagtctgttc       720
     tcgcggctgg gccacacact gagccgcttg atggcccctc ccggccccga cgaggtgcct       780
     tccgccgcga cagctcccag ggaaactgac ggctgggacg atgtgcagcc tcagatcgcg       840
     cccgacccgc gcagcaccgt gcccggcctc tgggacgacg ccgacgacct gacgcctgtc       900
     tcacctgtgg ccccggctcg cccggccccg tcgcccccgg tctacgacgc tgccgccgtg       960
     cccgcgctcg acatcgattt cagcgccgcg ccccgccgca gtcggacacc agcggaacag      1020
     atgcccgacc ccttcgcccg agcggcccgc gttcgcagcg ctcgccgcac cacgactccg      1080
     ctggtgcccg tgccccaaca attggacgcc gcagagatgc ctgccccgcg cccggcccgc      1140
     accccaccgg gccgacccgc gacggcgggc aacgtggccc cgcccagcgc tccccgcacg      1200
     gcccggcctc cctcccccac cctggctgac ttcgacctct gggacgatga ggaagacatg      1260
     cccttcggcc ccccggcgac gcctgcgccc gcagcggcca gcgtgcctca gatggtgccg      1320
     acaccacgcg cagcggcccg gcccaccccg cgcccagtat cgagtccagg gccgagccca      1380
     gtgccggtca gccccgcctc cgcgtcggtg agccacgccg cgccctggga agaacccgct      1440
     gctgggcgcc ccgctccggc ccccagtggg gtcagccgcc ggggcgccac ccgcctcgcg      1500
     ctgccgagcg agcagctcct cgacccgctg cccaacgggg cgcgcaacac cgtgcagatg      1560
     gacctcgacg ccgagcggcg cggcgacatg atcaacgaga cgctgcggca gttcggcctt      1620
     caggcgaagg tggtggacct cgcccgtggg cccaccgtga cccgctacga gatcgagccc      1680
     gcgcccggcg agaagatcag ccgcatcgcc agcctctcca acgacctcgc ccgcgctctg      1740
     gcggtaggtg gcgtgcgtgt ggaggctccg gtgccgggca agagtgtgat cggcctcgaa      1800
     gtgcccaatg ccgagcgcga acccgtcacc ttccatcagg cgacagccaa tccagccttc      1860
     aagaacaccc gcgccaagct gccgatcatc ctcggcaaaa gcatcgatgg ctcgatgatg      1920
     gtgggcgacc tcgccaagat gccgcacctg ctggtcgccg gctcgaccgg ctcgggcaag      1980
     tcggtgtgcg tcaacaccct catcacctcg ctgctctacc gctacctgcc gaccgaactg      2040
     cgcttcgtca tgatcgaccc caaaatggtc gaactcacgc cctacgacgg cattccccac      2100
     ctcgtgcgcc cagtggtgac caacccggca gacgcggcgg gggtgctgct cggcgcggtg      2160
     gcccacatgg aacggcgcta caagatgatg agtcaggtcg gcgccaagaa cctcgaacag      2220
     ttcaacgcca agatgcgcgc ggtgggcgag gttgagctgc cgcacctcgt catcatcatc      2280
     gacgaacttg ccgacctgat gatcaccagc cccaaggaag tcgagtcggc gatcatgcgc      2340
     ctggcgcaga tggcgcgcgc caccgggatg catctgattc tggcgacgca gcggcccagc      2400
     gtggacatcc tgaccagcct catcaaggtg aacattcctg cgcgcatcgc cttcgcggtc      2460
     agcagcagcc acgactcgcg caccattctc gacaccacgg gcgccgagcg gctgaccggc      2520
     atgggtgaca tgctgtttta tcagccgggg ctggtcaagc cgctgcgctt gcaggggccg      2580
     tacatcagcg aggccgagtc cgcccgcatc accgacgaac tgcgccggat gatgttcgac      2640
     gacgacttta tcgaagccta cggcgccgac ttcgagggca tgatttccag ctccggccct      2700
     ggtggggacc gctcgcagct cgatttcagc gacccgctgc tgcggcaggc cgcgctggtg      2760
     tgcattgagg aaggccaggg cagcgtctcg cgcctccagc gccggctctc ggtgggccac      2820
     gcccgcgccg gcaagctgat ggacctgctc gaagcgatga acatcgtggg gccgcaccag      2880
     ggcagcaagc cgcgcgaggt gctgatccac gaggccgatt tgcccgagta tttcggcaaa      2940
     tag                                                                    2943
//

If you have problems or comments...

PBIL Back to PBIL home page