(data stored in ACNUC30630 zone)

EMBL: AE000513.PE393

AE000513.PE393       Location/Qualifiers
FT   CDS_pept        411386..412051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0407"
FT                   /product="cytochrome c-type biogenesis protein, heme
FT                   exporter protein B"
FT                   /note="similar to GP:2865530 percent identity: 56.48;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09987"
FT                   /db_xref="GOA:Q9RXA8"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA8"
FT                   /protein_id="AAF09987.1"
FT                   /translation="MRAALSVFLKDLRLEGRSKDVLSTTLFFAGLVVLIMGFAFGPDTA
FT                   KMRDAAAGVLWCALAFASVLAANRAWAGEQESGALESLLLYPVAHEWLYLGKAAANALL
FT                   MLILGVVTAALTAIFFDVHFASLGLLALTLALGVLGLSLVTTFYSAITVNLRAKEALLP
FT                   VLSFPIIIPVMIGAVKSTVLLSGGFNPDDYWAWTRLLLGFDVVTLLVATFAFPHAVES"
     gtgagggccg cactcagcgt ctttctcaag gacttgcgac tggaaggccg cagcaaggat        60
     gtgctgtcca ccacgctgtt tttcgccgga ctggtggtgc tcatcatggg cttcgccttc       120
     ggccccgaca ccgccaagat gcgcgacgcc gccgccgggg tgctgtggtg cgctctggct       180
     tttgccagtg tgctggccgc caaccgcgcc tgggcgggcg agcaggaaag cggggcgctc       240
     gaaagcctgc tgctctaccc ggtggcccac gagtggctct acctcggcaa agcggcggcc       300
     aacgccctgc tgatgctcat tctgggcgtg gtgaccgccg cgctgaccgc cattttcttc       360
     gacgtgcact tcgccagcct ggggctgctc gcgctgaccc tcgcgctcgg cgtgctcggc       420
     ctgagcctcg tgaccacctt ctactcggcc atcaccgtca acctgcgggc caaagaagcc       480
     ttgctaccgg tcctgagctt ccccatcatc attccggtga tgattggggc ggtcaaaagt       540
     acagttctgc tcagcggcgg cttcaatccg gacgactact gggcgtggac gcggctgctg       600
     ctcggtttcg atgtggtcac gctgctggtg gcgaccttcg cttttccgca cgcggtggaa       660
     agctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page