(data stored in ACNUC30630 zone)

EMBL: AE000513.PE396

AE000513.PE396       Location/Qualifiers
FT   CDS_pept        413118..413501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0410"
FT                   /product="inorganic pyrophosphatase-related protein"
FT                   /note="similar to GB:AE000511 SP:P56153 PID:2313741 percent
FT                   identity: 71.43; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09989"
FT                   /db_xref="GOA:Q9RXA5"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RXA5"
FT                   /protein_id="AAF09989.1"
FT                   /translation="MKKCLNKPDLTPYLGQRVRVVVDRPLGSVHPRHPDLIYPVNYGEI
FT                   PGTLSGDGHPIDADLFGWEEPTEGGRRRSDCRRAGRGRRRRQAKLVVAREGTCWTDEAI
FT                   WQAAEFQERLFRTRLLRSDTLPT"
     ttgaagaagt gtttgaataa accggacctg acgccctacc tcggccagcg ggtgcgggtg        60
     gtcgtggacc ggcccctcgg cagcgtgcat ccccgtcatc ccgacctgat ttatcccgtc       120
     aattatgggg agattccggg caccctcagc ggcgacgggc atccgataga cgctgatctg       180
     ttcgggtggg aggagccgac tgaagggggc cgaaggcgaa gtgattgccg tcgtgctggg       240
     cgaggccgac gccgaagaca agctaagctg gtggtggcgc gggagggcac ctgctggaca       300
     gatgaggcca tctggcaggc cgccgagttt caggagcggc ttttccggac gcggcttttg       360
     cgctctgata ccttgcccac atga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page