(data stored in ACNUC30630 zone)

EMBL: AE000513.PE409

AE000513.PE409       Location/Qualifiers
FT   CDS_pept        complement(423080..423706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0423"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10011"
FT                   /db_xref="GOA:Q9RX92"
FT                   /db_xref="InterPro:IPR041247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX92"
FT                   /protein_id="AAF10011.1"
FT                   /translation="MKLSDVQKRLQAPFPAHTVSWKPAAFNAERTRALLLAHVDARAVQ
FT                   DRLDAVCPDDWSFEMEVVSGAEVPTVKGRLTVLGVTREDIGEAPEGSMAAYKAAASDAM
FT                   KRCAVQFGIGRYLYDLPKQWADWDDARRGPKHLPELPEWARPDHERTPGGAHLVQAMEQ
FT                   LRYELPEDLDLQREVYKHLKAALGSIHPVPTGPVPTNPVQGGRAA"
     atgaagctga gcgatgtcca gaaacgactg caagccccgt ttcccgctca taccgtgagc        60
     tggaagcccg ccgctttcaa cgccgagcgc acccgcgccc tgctgctggc tcacgtggac       120
     gcccgcgcgg tgcaggaccg actcgacgcc gtttgccccg acgactggag ctttgagatg       180
     gaagtggtgt ccggtgcgga agtgcccacc gtcaagggcc gcctgaccgt gctcggcgtg       240
     acccgcgagg atatcggcga ggcgcctgag ggcagcatgg cggcgtacaa ggcggcggcg       300
     agcgacgcca tgaagcgctg cgcggtgcag ttcggcatcg ggcgttacct ctacgacctg       360
     cccaagcagt gggccgactg ggacgatgcc cggcgcggcc ccaagcacct gcccgagctg       420
     cccgagtggg cacgccccga ccacgaacgc acccccggcg gcgcccacct ggtgcaggcg       480
     atggagcagt tgcgctacga actgcccgag gacctcgacc tgcaacgtga ggtctacaag       540
     cacctcaagg ccgcgctcgg cagcattcac cctgtcccga ctggtcccgt gccgaccaac       600
     ccggtgcagg gcgggagggc cgcatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page