(data stored in ACNUC30630 zone)

EMBL: AE000513.PE410

AE000513.PE410       Location/Qualifiers
FT   CDS_pept        423757..424491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0424"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="similar to SP:P48054 PID:1001734 PID:1001734 percent
FT                   identity: 63.50; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10002"
FT                   /db_xref="GOA:Q9RX91"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX91"
FT                   /protein_id="AAF10002.1"
FT                   /translation="MIKGKWRGVRGGPCLLCRPAFGRVGPGSGALTRARPSRAALHRRL
FT                   YLRPMPRTAAVTRTTKETDITVRLDLDAAPYEQPATGHGFFDHMLDALARHSRLGISIS
FT                   GTGDLHIEPHHLIEDTGITLGQALSQALGDRKGIERYGSAFVPMDETLAHVVLDLSGRA
FT                   HLAFEPETLDVYGDAGGMTHYHLREFLRGFCNHAGATLHVRLLAGREAHHVIEAVMKAF
FT                   ARALRDAVAVTSDALPSTKGSL"
     ttgattaagg ggaaatggag aggggttcgg ggcggcccct gcctgctctg tcggccagct        60
     ttcggcagag tgggccccgg ctccggcgca ctgacgcggg ctagaccctc ccgcgccgcc       120
     ctccaccgcc gcctctacct tcgtcctatg ccccgcaccg ccgccgtcac ccgcacgacc       180
     aaggaaaccg acatcaccgt ccggctcgac ctcgacgccg caccttacga gcagcccgcc       240
     accgggcacg gctttttcga ccatatgctc gacgcgctcg cccgccacag tcgcctcggt       300
     atcagtattt ccggcacggg cgacctgcac atcgagccgc accacctgat cgaggacacc       360
     ggcatcacgc tggggcaggc gctgtcgcag gcgctcggcg accgcaaagg catcgagcgc       420
     tacggctcgg ctttcgtgcc gatggacgaa acgctggcgc acgtggtcct cgacctctcg       480
     ggccgcgccc acctcgcctt cgagccggaa acgctggacg tgtacggcga cgcgggtggc       540
     atgacccact accacctgcg cgagtttctg cgcggctttt gcaaccacgc cggggccacg       600
     ctgcacgtgc gcctgctggc cgggcgcgag gcgcaccacg tcatcgaggc cgtcatgaag       660
     gcgtttgccc gtgccctgcg cgacgcggtg gcggtgactt cggacgcgct gccgagcacc       720
     aaggggagcc tgtag                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page