(data stored in ACNUC30630 zone)

EMBL: AE000513.PE411

AE000513.PE411       Location/Qualifiers
FT   CDS_pept        424532..425365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0425"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10012"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX90"
FT                   /protein_id="AAF10012.1"
FT                   /translation="MQRMLPLLALLSFASAQAQVSGPSETRVPRAAETDAIIRAVCSGK
FT                   ADLGRLSGCKQTVYEGRLSSEIRSPRTMLLLSSVLSGSFTAPGQKELLATFCTETESCS
FT                   GETVLLRQMRGQWQPVSLVPGFLPFNCLTYPKRNGTQAAVCMGENAKNEPIGDALKIAS
FT                   WTGGKLKVETVALFPLLQFRDFFGTGSQQCAGRWQYEAFGWNDRDRNADRVPDLTVLAS
FT                   VTTYQPTPELCKMGQGFDAQSSASARRDLTFVWTGETLRPTGTTAATLEKYSRGR"
     atgcaaagaa tgttgcccct gctggcgctg ctcagcttcg cctcggctca ggcgcaggtc        60
     tccggcccca gtgaaactcg cgtgccccgc gccgctgaaa ccgatgccat catccgcgcc       120
     gtatgcagcg gcaaagccga tctggggcgg ctcagcgggt gtaagcagac cgtctatgaa       180
     ggtcgcctga gttcggagat tcgcagtccg cggaccatgc tgctgctgtc cagcgtcctt       240
     tccgggtctt ttacggcgcc gggtcaaaag gaactgctgg cgacgttctg caccgaaacc       300
     gaaagctgct cgggcgaaac ggtattgctg cgccagatgc gcgggcagtg gcagcccgtc       360
     agcctcgtgc cgggctttct gccgttcaac tgcctcacct accccaagcg caatggcacg       420
     caggccgccg tctgcatggg cgaaaacgcc aaaaacgagc cgattggaga cgccctgaaa       480
     atcgcctcct ggacgggcgg taagctgaag gtggagacgg tggccctctt tccgctcttg       540
     cagttccgcg actttttcgg gactggctcg cagcagtgcg ccgggcgctg gcagtacgaa       600
     gccttcggct ggaacgaccg ggaccgcaac gccgaccggg tgcctgacct caccgtgctg       660
     gcttctgtca cgacgtacca gccgacgccc gagttgtgca aaatggggca gggctttgac       720
     gcgcagagca gcgcttctgc ccgccgcgac cttaccttcg tctggacagg tgaaaccctc       780
     aggcccaccg gcacgaccgc cgccacgctg gagaagtact ctagggggcg atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page