(data stored in ACNUC30630 zone)

EMBL: AE000513.PE419

AE000513.PE419       Location/Qualifiers
FT   CDS_pept        431543..432376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0433"
FT                   /product="beta-lactamase, putative"
FT                   /note="similar to GP:1928922 percent identity: 45.18;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10013"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX82"
FT                   /protein_id="AAF10013.1"
FT                   /translation="MMPDFLAELRRAGYAGEVGLLVTDFAGRELYAQAADAVFPAASTI
FT                   KVPLLLFALEQAGRGDLDLIERVTLRAEDRVPGAGVLHELGLGLALTWQDVLTLMIVVS
FT                   DNTATNLLIERLGQDHFNLWLTARGLNSTRLIGPLQLPPERQNEAQRRGERNRTTARDQ
FT                   VALLLSLLRGDGLTPQMQHLALDILSRQHLRDLIGRGVPAGPDGEPLYRVASKSGELRG
FT                   VHHDVGLLWAPRPLVVALLSQGGEDPREHPGNRDVTRLSAALWPLLAELGETETP"
     ttgatgccgg attttctggc cgagctgcgc cgcgccgggt acgcgggtga ggtggggctg        60
     ctcgtcaccg attttgcagg ccgcgaattg tacgcccaag ccgccgacgc ggtatttccc       120
     gctgccagca ccatcaaagt gccgctgctg ctgttcgcgc tcgaacaggc tgggcgcggc       180
     gacctcgacc tgatcgagcg ggtgaccctg cgcgccgaag accgggtgcc gggcgcgggg       240
     gtgctgcacg agctggggct ggggctggcg ctgacctggc aggacgtgct gaccttgatg       300
     atcgtggtga gcgacaatac cgcgaccaac ctgctgatcg agcggctcgg tcaggatcac       360
     ttcaaccttt ggctgacggc acgcggcctg aacagcaccc ggctgatcgg cccgttgcaa       420
     ctcccccccg agcgccagaa cgaggcccag cgccggggtg agcgcaaccg cacgacggcg       480
     cgggatcagg tggcgctgct gctgtccctg ctgcgcggcg atgggctgac gccccagatg       540
     caacacctcg ctctcgacat cctgagccgc cagcacctgc gcgacctcat cgggcggggt       600
     gttcccgccg ggccggacgg cgagccgctc taccgggtgg cctccaaatc gggcgaactg       660
     cgcggcgttc accacgatgt cggtctgctc tgggccccgc gcccgctggt cgtcgctttg       720
     ctctcgcagg gtggggaaga cccgcgcgag catccgggca accgcgacgt gacccggctc       780
     tcggcggcgc tctggccgct gctggccgag ctgggtgaaa ccgagacgcc ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page