(data stored in ACNUC30630 zone)

EMBL: AE000513.PE42

AE000513.PE42        Location/Qualifiers
FT   CDS_pept        complement(41990..42775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09637"
FT                   /db_xref="GOA:Q9RYA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038764"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA7"
FT                   /protein_id="AAF09637.1"
FT                   /translation="MTVPGYVIRDVTDPQAMRELEDVQAAAWGFEDREVLPATMFRISA
FT                   ATGGIVLAAYRAEGGPAVGLAYGFPALGGLLGRELPGRGHDLWHHSHFLALRPEVRGSG
FT                   LAVALKLAQRGRALAQGLTRMTWTFDPLVARNARLNFGKLGVTASTYLPDWYAPHADRL
FT                   LVEWDLTRPHVPAPASPPLGTVVLRGVGARPGTPDLSADAPTVLAEVPLAVSDEERAPW
FT                   RLALRDTLTAYLGRGYRVTDLARESERAFYVLKRHPEGQ"
     gtgacggtcc ccggctacgt catccgcgac gtgaccgacc cgcaggcgat gcgtgaactg        60
     gaagacgtgc aggcagcggc ctggggcttt gaggaccgcg aggtgctacc cgccaccatg       120
     ttccgcatca gcgcagccac cgggggcatc gtgctggcgg cctaccgcgc ggagggcggc       180
     ccggcggtgg ggctggccta cgggttcccg gcgctgggcg ggctgctggg gagggagctg       240
     ccgggccggg gccacgacct ctggcaccac tcgcactttc tggcgctgcg gcccgaggtg       300
     cgcggcagcg ggctggcggt ggccctcaaa ctcgcgcagc gcgggcgggc gctggcgcag       360
     ggcctgacgc gcatgacctg gaccttcgac ccgctggtgg cccgcaacgc ccggctcaac       420
     ttcggcaagc tgggagtgac ggcgagcacc tacctccccg actggtacgc cccacacgcc       480
     gaccgcctgc tggtggagtg ggacctgacc cggccccacg ttcctgcgcc cgcctcgccc       540
     ccgctgggca ccgtggtcct gcgtggcgtc ggggcacgcc ctggcacgcc ggacctctcc       600
     gccgacgcgc ccaccgtgct ggcagaagtg ccgctggccg tctccgacga ggagcgcgcc       660
     ccctggcgcc tcgccctacg cgacacgctg acggcttacc tggggcgcgg ctaccgcgtg       720
     accgacctgg cacgggaaag cgagcgggcg ttttacgtgc tgaagcgcca ccccgaagga       780
     caataa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page