(data stored in ACNUC30630 zone)

EMBL: AE000513.PE423

AE000513.PE423       Location/Qualifiers
FT   CDS_pept        435588..435806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10023"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX78"
FT                   /protein_id="AAF10023.1"
FT                   /translation="MEQAYSDPVDHFTLELAREAKRLELTAGGEDNDPERLLAFATFVL
FT                   SELAARGLIPDERPAIGCWAAPRSTGN"
     ttggaacagg cgtactctga cccggtggac cacttcaccc tggaactcgc ccgcgaggca        60
     aagcggctgg aactgaccgc tggcggcgag gacaacgacc ccgagcgcct gctggcattt       120
     gctacgtttg ttctgtccga gctggcggct cgagggctca tacctgacga gcgccccgca       180
     atcggctgct gggcagcccc gcgctcgacg ggaaactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page