(data stored in ACNUC30630 zone)

EMBL: AE000513.PE432

AE000513.PE432       Location/Qualifiers
FT   CDS_pept        complement(442679..442990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AL123456 percent identity: 56.41;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10025"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX69"
FT                   /protein_id="AAF10025.1"
FT                   /translation="MITVMNRIGVKPEFAAQFEESFRNRAGLVDGMPGFIRNEVLKPTK
FT                   PGDPYIVLTYWQDEPSFRAWTESDEFKQGHARSGSLPHDAFTGRPVLEVHDVLLSSDN"
     atgattaccg tcatgaaccg catcggcgtc aagccggagt ttgccgccca gttcgaggaa        60
     agctttcgca accgcgccgg cttggtggac ggcatgcccg gctttatccg caacgaagtg       120
     ctcaagccca ccaagcccgg cgacccctac atcgtgctga cctactggca ggacgagccc       180
     tccttccgcg cctggaccga gtccgacgag ttcaagcagg gccacgcccg cagcggcagc       240
     ctcccccacg acgccttcac cgggcgcccg gtgctcgaag tccacgacgt gttgctgagc       300
     agcgacaact ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page