(data stored in ACNUC30630 zone)

EMBL: AE000513.PE436

AE000513.PE436       Location/Qualifiers
FT   CDS_pept        444716..445561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:2792327 percent identity: 45.60;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10027"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX65"
FT                   /protein_id="AAF10027.1"
FT                   /translation="MTSSSTPAPRATLLVIFAHPDDEAFSVGGTLTHYARQGVRVVLAC
FT                   ATRGEAGKITVPGMTVDDLGAQREQELREACRALEIEPPVFLDYHDSGRYERTRHDDPT
FT                   ALMNVNPLDAEVKLRALIEDVQPQVIVTFDPHGAYGHVDHLQMHRATVAAFFSTGHLPS
FT                   GGPQRLYYTAMTHQAAAQISRLGHDQSLDPLVYGVSDSTLAVTMDVGAYAENKKAALAA
FT                   HGTQMGETSLMGRLSPDERAALEERMLGKESFSIGGTRTAIREYPLRGLFDGVGVEGLV
FT                   "
     atgacttcct ccagcacccc tgccccacgc gcgactctgc tcgtcatctt tgcccacccc        60
     gacgacgaag ccttcagcgt gggcggcacc ctgacccact acgcccgcca gggggtgcgg       120
     gtggtcctcg cctgcgccac ccgcggcgag gcgggcaaaa tcaccgtgcc cggcatgacg       180
     gtggacgacc tcggggccca gcgcgagcag gagttgcgcg aggcctgccg cgccctggag       240
     attgagccgc cggtctttct ggactaccac gactcgggcc gctacgagcg cacccgccac       300
     gacgacccca ccgccctgat gaacgtcaac ccgctggacg cagaagtcaa actccgcgcc       360
     ctgatcgagg acgtgcagcc gcaggtcatc gtgaccttcg acccgcacgg cgcttacggg       420
     catgtggatc acctccagat gcaccgcgcg accgtcgccg cctttttcag caccgggcac       480
     ctgccctccg gcggcccgca gcgcctgtac tacaccgcca tgacccacca ggccgctgcc       540
     cagatttcgc gcctgggcca cgaccagtcc ctcgaccccc tcgtctacgg cgtctccgac       600
     tccaccctcg ccgtcacgat ggacgtgggc gcctacgccg agaacaagaa ggccgccctc       660
     gccgcgcacg gcacccagat gggcgaaacc agcttgatgg gccgcctgtc gcccgacgaa       720
     cgcgccgcgc tggaagagcg gatgctcggc aaagagagct tcagcatcgg cggcacccgc       780
     acagcgattc gggagtaccc gctgcggggg ctgtttgatg gggtgggggt tgaggggttg       840
     gtttga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page