(data stored in ACNUC30630 zone)

EMBL: AE000513.PE439

AE000513.PE439       Location/Qualifiers
FT   CDS_pept        complement(447757..448332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0453"
FT                   /product="guanyl-specific ribonuclease SA"
FT                   /note="similar to SP:P30289 percent identity: 60.51;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10029"
FT                   /db_xref="GOA:Q9RX62"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX62"
FT                   /protein_id="AAF10029.1"
FT                   /translation="MTLPTMPQDPSASFHLPQAALPTLRRMTSPLRMPLLLLAVFLPSC
FT                   SAQSGQTQTGQTQTGQPRTQSSASVSSIPATPPASRPSASRRPARDPLSGLAFVNVAQL
FT                   PPEGQQLLTLIARGGPFRYSKDGVTFGNREGILPQQARGYYREYTVRTPGESDRGARRV
FT                   VCGGQPVTNTAECYYTADHYASFRRIRP"
     atgaccctcc ccaccatgcc ccaagacccg tcagcttcct ttcatctgcc gcaggcggcg        60
     ctgcctacac tgcggcgcat gacttcgccc ctgcgcatgc cgctgctgct cctcgcggtc       120
     ttcttgccct cctgctcggc ccagagcggc cagactcaga ccggccagac tcagaccggc       180
     caaccacgga cgcagagcag cgccagcgtc tccagcattc ccgcaactcc gcccgccagc       240
     cgcccatctg ccagccgccg cccggcccgt gacccgctga gtggcctggc ctttgtcaac       300
     gtcgcgcagc tcccgcctga aggccagcag ctgctgacgc tgatcgccag gggcggcccc       360
     ttccgctaca gtaaggacgg cgtgactttc ggcaaccgcg aggggatttt gccccagcag       420
     gcgcgggggt attaccgcga gtacaccgtc cggacgcccg gcgaatccga ccggggcgcg       480
     cgccgcgtcg tgtgcggcgg gcagccggtc acgaacaccg ccgagtgcta ctacaccgcc       540
     gaccactacg ccagtttcag gagaatccgg ccatga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page