(data stored in ACNUC30630 zone)

EMBL: AE000513.PE443

AE000513.PE443       Location/Qualifiers
FT   CDS_pept        450847..451269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0457"
FT                   /product="biopolymer transport protein, putative"
FT                   /note="similar to PID:1652034 percent identity: 61.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10033"
FT                   /db_xref="GOA:Q9RX58"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX58"
FT                   /protein_id="AAF10033.1"
FT                   /translation="MSVPRRRLRDDVEGVTFDFAPMVDIVLLLLIFFFLTSNLGARQNV
FT                   LPLDLPRASTTVQATPDIPIVTVHKTGRIYLNGYATNLEQLEQKLPALVKKSGGVVGVR
FT                   ADERGNYGTVVQVMDAVKKAGGERLALGTRNADSDK"
     atgagcgtgc cgcgcagaag gctgcgggac gatgtcgaag gcgtgacctt tgatttcgcg        60
     ccgatggtgg acatcgtgct gctgctgctg attttctttt tcctgaccag taacctgggt       120
     gcccggcaaa atgtcttgcc gctcgacctg ccgcgcgcca gcaccaccgt gcaggccacc       180
     cctgacattc ccatcgtgac cgtacacaag acgggccgca tctatctcaa cggctacgcc       240
     accaacctcg aacagctcga acagaaactg cccgcgctgg tcaagaaatc cggcggtgtg       300
     gtgggtgtac gcgccgacga gcgcggcaac tacgggaccg tggtgcaggt gatggacgcc       360
     gtgaagaaag cgggcggcga gcgcctcgcc ctgggcaccc gcaacgcgga ctccgacaag       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page