(data stored in ACNUC30630 zone)

EMBL: AE000513.PE445

AE000513.PE445       Location/Qualifiers
FT   CDS_pept        453926..454636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10043"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX56"
FT                   /protein_id="AAF10043.1"
FT                   /translation="MRLLDFRKPLLLSLTALLSAPAFAWVPKLDDATAKNVIDGAYGRR
FT                   DLPSTYLTVDLGVKDGQFVSGPESVKVFDGGAQCVTDWLAAPGDFSKGSRLGSVTASGQ
FT                   ADQLYFQATDARDNFRNLSAADALGADLSKARLADGELRVDIAVRGLPSEKARDAYLVR
FT                   MRSADGKLVAPVRRSYVNDFKQGEDGKWSGTLVYYFKPLDAGVGASDRVDLLVRTEADT
FT                   NCAYNVALNLASFQ"
     atgcgcctac ttgatttccg taagcccctg ctgctgtccc tgacggcctt gctctcggcc        60
     cccgcgttcg cctgggtgcc caagctcgac gacgccaccg ccaagaacgt catcgacggg       120
     gcctatggcc gccgcgacct gccgagcact tacctgacgg tggacctcgg cgtgaaagac       180
     ggccagttcg tctccggccc cgagagtgtc aaggtgttcg acggcggcgc ccagtgcgtg       240
     accgactggc tcgccgcgcc gggcgacttc agcaagggca gccgcctggg ctcggtcacc       300
     gccagcggtc aggccgacca gctctacttt caggccaccg acgcccgcga caacttccgc       360
     aacctcagcg ccgctgacgc tctgggtgcc gacctgagca aggcccgcct cgccgacggc       420
     gaactgcgcg tggacatcgc cgtgcgcggc ctgcccagcg aaaaggcccg cgacgcctac       480
     ctggtgcgga tgcgctccgc cgacggcaag ctggtggccc cggtgcgccg cagctacgtc       540
     aacgacttca agcagggcga ggacggcaag tggagcggca ccctggtgta ctacttcaag       600
     ccgctcgacg ccggggtggg cgccagtgac cgggtggacc tgctcgtccg caccgaagcc       660
     gacacgaact gcgcctacaa cgtggcgctg aatctggcga gcttccagta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page