(data stored in ACNUC30630 zone)

EMBL: AE000513.PE45

AE000513.PE45        Location/Qualifiers
FT   CDS_pept        44596..45102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:1575691 percent identity: 47.58;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09639"
FT                   /db_xref="InterPro:IPR004830"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA4"
FT                   /protein_id="AAF09639.1"
FT                   /translation="MAGHPNTPPETLAALGAEFPAEVLGNPALPLLRLAQPGLLARWPV
FT                   RTLEALAAAPAAPVWLLRLAAAHEKIDVQLAAVTRPDLPGDVLLKLSHSPFWTIREAVA
FT                   RKPQLPPGVLGQLGHDLDYGVRLSVANRSDLSRELRGALRRDPHPLVRAVVILGEPQVS
FT                   ELSLS"
     gtggccgggc accccaacac accgccagag accctggccg cgctgggggc cgagtttccc        60
     gccgaggtgc tgggcaaccc ggcgctgccg ctgctgcgcc tcgcccagcc ggggttgctg       120
     gcccgctggc ctgtgcggac gctcgaagct ctggccgcgg ccccggcagc ccccgtctgg       180
     ttgctgcggc tcgcggcggc gcacgagaag attgacgtgc aactcgccgc cgtgacccgc       240
     cctgacctgc cgggcgacgt gctgttaaag ctctcgcact cgcccttctg gaccatccgc       300
     gaggcggtgg cgcgcaaacc gcagttgccg ccgggcgtgc tggggcagct cgggcacgac       360
     ctcgactacg gcgtgcggct gtcggtggcg aaccgcagcg acctgtcccg cgaattgcgc       420
     ggggcgctgc gccgtgaccc gcatccgctg gtgcgggcgg tggtcattct gggtgagccg       480
     caggtcagcg aactcagtct ctcttga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page