(data stored in ACNUC30630 zone)

EMBL: AE000513.PE452

AE000513.PE452       Location/Qualifiers
FT   CDS_pept        complement(465081..467498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0466"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="similar to PID:1001414 PID:1001455 percent identity:
FT                   61.20; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10046"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX49"
FT                   /protein_id="AAF10046.1"
FT                   /translation="MTLCSGRPRPPGRDEAPTSMPSSVPNLDQLLQQAGLSTEVPPSLG
FT                   EWQNLLWRVRAALDRGRDAAQATGWAQHLLDKLSLPVLVLDRQGTVIHASEACGALGWS
FT                   HDLRGRPLAELLSSPLEDLRLSNLLKRVWQGERLHQVPLSLRHTEGRLQLAEASLLPLH
FT                   AASGESTAAYVAMSITTTELHGQSDDNARTDRQYFYESLLAALPASLAVLGPDQRYRFC
FT                   NPAAIGNPQIREWIMGHTDAEYVAERGFPPELATERGRHMDEAARERKTVQFEERMLRP
FT                   DGEPVYQLRNYTPLFDENGELLLYLGHGVDVTELRRTQEALRELNAQLEERVEARTAEL
FT                   EALSRQLQHDALHDSLTGLPNRALFSDRLSQAIARSKLPGGPQYAVLFLDVDRFKGIND
FT                   TLGHPTGDAMLVEMARRLRACLRATDTVARLGGDEFTILLEPLQSTEQAAQVAARIQDA
FT                   LRRPMQMPAAGPGGLPGGWHQVTMSASLGIVHSQPDYDSAMAVLRDADIAMYRAKDGGR
FT                   AKYRVFTPEMREHILHVNRMEHELRRALAADELRVRYQPVLDLDRGRIEGFEALVRWQH
FT                   PERGLLGPDDFTPIAEESGLLPDIDRWVLARACRELVQWQRLYPHDPPLHLSVNFCSQH
FT                   LAAPDVHERVKELLQRTGFDPGRLNLEITESSLLSQTGDVQRNMERLRQLGVRLHLDDF
FT                   GTGYSSLSYLQLYPIDVLKIDRSFVQGMLDNDSNAELVRTIVAMAKNLNLKVVAEGIED
FT                   PRQLAALRGLGCDAGQGFLFSPALDVHAARTLVAEGQHHRRPGWRYDDLPPA"
     atgactctgt gttcaggtcg gccccgcccg cctggacgtg acgaggctcc cacatctatg        60
     cccagctcgg ttcccaatct cgatcaactg cttcagcagg ctggcctcag caccgaggtg       120
     ccgcccagcc tcggggagtg gcaaaacctg ctgtggcggg tgcgcgccgc cctcgaccgt       180
     ggccgcgacg cggcgcaggc gaccggctgg gcgcagcacc tgctcgacaa gctgagcctg       240
     ccggtgctcg tgctcgaccg ccagggcacg gtgattcacg ccagcgaggc gtgcggggcg       300
     ctgggctgga gccacgacct gcggggccgg cccctcgccg agctgctgag ttcgccgctc       360
     gaggacctgc ggctgagcaa cctgctcaag cgggtgtggc agggcgagcg gctgcatcag       420
     gtgccgctct cgctgcggca cacggagggg cgactgcaac tggccgaggc ctcgctgctg       480
     cccctgcacg cggcgagcgg cgagagtacg gcggcctacg tggcgatgtc gatcaccacc       540
     accgagctgc acggtcagtc cgacgacaac gcccgcaccg accggcagta tttctacgag       600
     tcgctgctcg cggcgctgcc ggcctcgctg gcggtgctgg gaccggacca gcgctaccgc       660
     ttttgcaacc cggcggccat cggcaacccg cagattcgcg agtggatcat gggccacacc       720
     gacgccgagt acgtggccga gcgcggcttt cccccggagc tggccacgga gcgcgggcgc       780
     cacatggacg aggcggcgcg cgagcgcaaa accgtgcagt tcgaggaacg gatgctgcgc       840
     ccggacggtg agccggtcta ccagctgcgc aactacactc cgctgttcga cgagaacggt       900
     gagctgctgc tctacctggg gcacggcgtc gacgtgaccg aactgcgccg cacccaggag       960
     gccctgcgcg aactcaacgc ccagctcgag gaaagggtgg aggcccgcac cgccgaactc      1020
     gaagcgctct cgcgccagct gcagcacgac gccctgcacg actcgctgac cgggctgccc      1080
     aaccgggcgc tgttcagtga ccgcctgtct caggccatcg cccgctccaa gctgcccggc      1140
     gggccgcagt acgccgtgct gtttctcgat gtagaccgct tcaagggcat caacgacacc      1200
     ctgggccacc ccaccggcga cgccatgctg gtcgaaatgg cccggcgcct gcgcgcttgc      1260
     ctgcgggcca ccgacaccgt ggcgcggctg ggcggcgacg aattcaccat cttgctcgag      1320
     ccgctgcaaa gtaccgaaca ggcggcgcag gtggccgccc gcattcaaga cgccctgcgc      1380
     cggcccatgc agatgccggc ggccggcccg ggcggcctgc ccggcggctg gcatcaggtc      1440
     accatgtcgg ccagcctggg catcgtgcac agccagcccg actacgactc ggccatggcg      1500
     gtgctgcgcg acgccgacat cgccatgtac cgcgccaagg acggcggacg cgccaagtac      1560
     cgggtgttta cgcccgaaat gcgcgagcac atcctgcacg tcaaccgcat ggagcacgag      1620
     ttgcgccgcg ccctggccgc cgacgaactg cgggtgcgtt accagccggt gctcgacctg      1680
     gaccggggcc gcatcgaggg cttcgaggcg ctggtgcgct ggcagcaccc cgagcgcggc      1740
     ctgctggggc ccgacgactt caccccgatt gccgaggaaa gcggtctgct gcccgacatc      1800
     gaccgctggg tgctggcgcg cgcctgccgc gagctggtgc agtggcagcg gctttacccg      1860
     cacgacccgc cgctccacct cagcgtgaac ttttgcagcc agcacctcgc cgcgcccgac      1920
     gtgcacgaac gggtcaagga gttgctgcaa cgcactggct tcgaccctgg gcggctcaat      1980
     ctggaaatca ccgagagcag cctgctttcc cagaccggcg acgtgcagcg caacatggag      2040
     cggctgcggc agctcggcgt gcggctgcac ctcgacgatt tcggcaccgg gtactcatcg      2100
     ctcagttact tgcagctcta tcccatcgac gtgctcaaga tcgaccgctc gttcgtgcag      2160
     gggatgctgg acaacgacag caacgccgaa ctcgtgcgca ccatcgtcgc catggcgaag      2220
     aacctgaacc tcaaagtcgt ggccgaaggc atcgaagacc cccggcagct cgccgctctg      2280
     cgcggcctcg gctgtgacgc gggccagggc ttcttatttt ccccggccct cgatgtgcac      2340
     gccgcccgca ccctcgtcgc cgaagggcaa caccaccggc gccccggctg gcgctacgac      2400
     gacctgccgc cggcctga                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page