(data stored in ACNUC30630 zone)

EMBL: AE000513.PE454

AE000513.PE454       Location/Qualifiers
FT   CDS_pept        complement(469213..469884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0468"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10054"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:3M33"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX47"
FT                   /protein_id="AAF10054.1"
FT                   /translation="MNHSRESYDRLARELGGYRHPWARVLSGPDPELTFDLWLSRLLTP
FT                   QTRVLEAGCGHGPDAARFGPQAARWAAYDFSPELLKLARANAPHADVYEWNGKGELPAG
FT                   LGAPFGLIVSRRGPTSVILRLPELAAPDAHFLYVGPRLNVPEVPERLAAVGWDIVAEDH
FT                   VSVLAHAPTWEDWQMRGEFMGKLARRADWDAEATVRGMPYREERHLVLARQLGVARKLG
FT                   A"
     gtgaatcatt cccgcgaaag ttacgaccgc ctcgcccgcg aactcggcgg ctaccggcac        60
     ccctgggcgc gggtgctgag cggccccgac ccggaactca ccttcgacct gtggctgagc       120
     cgcctgctca cgccgcagac gcgggtgctg gaagcgggct gcgggcacgg tcccgatgcc       180
     gcccgtttcg gcccgcaggc ggcgcgctgg gcggcctacg acttctcgcc ggagttgctg       240
     aaactggccc gcgccaacgc cccgcacgcc gatgtatacg agtggaacgg caagggcgag       300
     cttcctgctg ggctaggcgc tcccttcggc ctgatcgtct cgcggcgagg gccgacctca       360
     gtgattttgc gcctgcccga acttgctgcg ccggacgcgc attttttata cgtcgggccg       420
     cgcctgaacg tgccagaagt gcccgagcgt ctggcggcgg tgggctggga catcgtggcc       480
     gaagaccatg tgtcggtgct ggcccacgcg ccgacctggg aggactggca gatgcgcggc       540
     gaatttatgg gaaaactggc gcggcgggct gactgggacg cggaagcgac ggtacggggg       600
     atgccctacc gcgaggagcg gcaccttgtc ctggcgcgtc aactgggtgt ggcgcgtaag       660
     ctgggcgcat ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page