(data stored in ACNUC30630 zone)

EMBL: AE000513.PE455

AE000513.PE455       Location/Qualifiers
FT   CDS_pept        complement(469881..470441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to PID:1651963 percent identity: 56.00;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10048"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX46"
FT                   /protein_id="AAF10048.1"
FT                   /translation="MTGPAFKAMSVEEYLRSEENSPVKHEYVAGFIYPLHAQAGVSRTH
FT                   SAISVNIVATLHPHARKQGCRLHLADMRLRIEERNTFYYPDVMLVCDTDTGSDLAETAP
FT                   CLLVEILSPSTAQIDRVGKWAMYTALPSLQSYLIVHQDERRVVEYRREGTEWQMREVVQ
FT                   DGELWIDCLEMSLSLEDIFGGVL"
     atgaccggcc ccgccttcaa agcgatgagc gtggaagaat acttgcgctc agaggaaaac        60
     agtccggtca agcacgagta cgtggccggg ttcatctacc cgctgcacgc ccaggcgggg       120
     gtcagccgca ctcattcggc catttcggtc aatatcgtgg cgacgttgca cccacacgcc       180
     cgaaaacagg gctgccggct gcatctggcc gacatgcgcc tgcggatcga ggagcgcaac       240
     acgttttatt accccgacgt gatgctcgtc tgcgacaccg atacaggcag cgacctggct       300
     gaaacggcgc cgtgcctgct ggtggaaatc ctctcgccgt ccaccgcgca gattgaccgg       360
     gtgggcaaat gggcgatgta cacggccttg ccgagcctgc aaagctacct catcgttcat       420
     caggacgagc ggcgggtggt ggagtaccgc cgtgaaggaa ccgaatggca gatgcgcgaa       480
     gtcgtgcagg acggcgaact atggattgat tgcctggaga tgagcctgag tctggaggac       540
     atcttcggcg gcgtgctgtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page