(data stored in ACNUC30630 zone)

EMBL: AE000513.PE458

AE000513.PE458       Location/Qualifiers
FT   CDS_pept        472040..473263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0472"
FT                   /product="tetracycline-efflux transporter"
FT                   /note="similar to SP:P02982 percent identity: 62.82;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10051"
FT                   /db_xref="GOA:Q9RX43"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX43"
FT                   /protein_id="AAF10051.1"
FT                   /translation="MGQMPRRPPALLFILLTALIDVMGIGLIIPVLPGLVKELAGSEAG
FT                   GARFIGVLTAAYAAMQFIFAPILGTLSDRFGRRPVLLLSLAGMVLDYLLLFFSPNLWWL
FT                   LVGRLIAGVTGASLTVANAYIADVTAPEDRAKNFGRLGATWGVGFILGPMLGGWLGEHG
FT                   LRAPFLFAAGLTALNFLYGLLVLPESLPPEKRGAAGGGTLNPFTPLRALTEYPLLRGLT
FT                   LTFVLLGLAGQVIVSTWVLYTEGVLRWSPLQNGIAFAVYGLLTAGVQAGLISPFIARFG
FT                   ERRTIMTGLVASTLEFVVLSVARSAPVLYLSLVVGALGGLAQPAMQGLISRQVGEQEQG
FT                   RVMGAITSLNSLVGVFGPLLATSVFAAGQGAGFPGAAFVLGAVLSILGTVLILSVLRGI
FT                   PGTGRAMK"
     gtgggccaga tgccgcgtcg cccgcctgcc ctgctcttca ttttgctgac cgccctgatt        60
     gacgtgatgg gcatcggcct catcattccg gtgctgccgg ggctggtcaa ggaactggcg       120
     gggtccgagg ccggcggagc gcgctttatc ggcgtgctga cggcggctta cgcggcgatg       180
     cagttcatct tcgcgccgat tctgggcacg ctctcggacc gcttcgggcg ccgcccggtg       240
     ctgctgctct cgctggcggg gatggtgctc gattacctgc tgctgttttt ctcgcccaac       300
     ctgtggtggt tgctggtcgg gcggctcatt gccggagtta ccggcgccag cctgaccgtc       360
     gccaacgcct acatcgccga cgtgacggct cccgaggacc gcgccaagaa cttcgggcgg       420
     ctgggcgcca cctggggtgt ggggttcatc ctggggccga tgttgggcgg ctggctgggc       480
     gaacatgggc tgcgggcgcc gttcctgttt gccgctgggc tgaccgcctt gaactttctg       540
     tacggcctgc tggtgctgcc cgagtcgttg ccgccggaaa aacgcggcgc ggcgggcggc       600
     ggcaccctca atccgtttac gccgctgcgc gcactgaccg aatacccgct gctgcggggg       660
     ctgaccctga ccttcgtgct gctgggcctc gccgggcagg tcatcgtgag cacctgggtg       720
     ctgtacaccg agggcgtgct gcgctggtcg ccgctgcaaa acgggattgc cttcgcggtg       780
     tacggcctgc tgacggcggg cgtgcaggcg gggctgattt cgcccttcat cgcccgcttc       840
     ggcgaacggc gcaccatcat gaccgggctg gtggcctcca ccctggaatt cgtggtgctg       900
     agcgtggccc gcagcgcgcc ggtgctgtat ctgtcgctgg tggtgggggc gctgggaggg       960
     ctcgcgcagc ccgccatgca gggcctgatt tcgcgccagg tcggcgagca ggagcagggc      1020
     cgcgtgatgg gggcaatcac cagcctcaac agcttggtgg gcgtcttcgg gccgctgctg      1080
     gcgacgagcg tgttcgctgc cggccagggc gcgggctttc ccggcgcggc gttcgtgctg      1140
     ggcgcggtgc tgtctattct cggcaccgtg cttattctca gcgtgctgcg cgggattccg      1200
     gggacggggc gggcgatgaa gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page