(data stored in ACNUC30630 zone)

EMBL: AE000513.PE467

AE000513.PE467       Location/Qualifiers
FT   CDS_pept        complement(484534..485061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10064"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX34"
FT                   /protein_id="AAF10064.1"
FT                   /translation="MGAVLILLVVFGVIGFVTYRDQQRQRQQPPLPGPAASPMLPDPVA
FT                   PAEPVSESLLLALPEPARRHAWELLCLVHDGLSEGSSADTRTRFLLAQTRQSYLPDTLR
FT                   AYLHLTDGARRQLTAQGQSPEQLLDEQLALMTDGVHEALRRDHAAADRLLTQGRFLRER
FT                   FGAGAEELRVRK"
     atgggcgcag tgctgattct gttggtggtc ttcggtgtca tcgggtttgt cacttaccgg        60
     gaccagcaac ggcagcgcca gcagcccccg ctccccggcc cggcggcttc cccgatgctg       120
     cccgacccgg tagcccctgc tgaacccgtg agcgaatctc tactgctcgc ccttcccgag       180
     ccggctcgcc gccacgcctg ggagctgctg tgtctcgtcc acgacggcct aagcgagggc       240
     agcagcgccg acacccgcac ccgctttttg ctcgcccaga cgcgccagag ttatctgccc       300
     gacaccctgc gggcctacct gcacctgacc gacggcgccc ggcgccagct caccgcgcag       360
     ggtcagagcc ccgagcaact gctcgacgag caactcgccc tgatgaccga cggcgtccac       420
     gaagccctgc gccgcgacca cgccgccgca gaccgcctgc tcacccaggg ccgcttcctg       480
     cgcgaacgat tcggggcggg agcggaagaa ttgcgagtaa gaaaataa                    528
//

If you have problems or comments...

PBIL Back to PBIL home page