(data stored in ACNUC30630 zone)

EMBL: AE000513.PE474

AE000513.PE474       Location/Qualifiers
FT   CDS_pept        complement(491029..491529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10077"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX27"
FT                   /protein_id="AAF10077.1"
FT                   /translation="MSNPLKFVLSAAALSLLSLTTATAQFATPEGQSTFTPAVTAEIPA
FT                   ATPVVSDLLGASRGAGRSLVIKATAYNSLSSQTDGTPHITATGTRTRPGVVALSRDLLR
FT                   VFPYGTRVTIQDLSGRYNFAGRVFIVEDTMHPRKTNQVDIWMPTYRDAISFGTSTVRIT
FT                   ALR"
     atgtcgaacc ccctgaagtt tgtgctgtct gctgccgccc tgagtctgct gtccctgacc        60
     accgccaccg cgcagttcgc cacgccggaa ggccaaagca cctttacgcc cgctgtgacc       120
     gccgaaatcc ccgccgcgac cccggtcgtc agtgacctgc tcggcgcctc gcgcggtgcg       180
     ggccgcagcc tggtcattaa ggcaacggcg tacaacagcc tgtcgagcca gaccgacggc       240
     accccccaca tcaccgccac cggcacccgc acccgccccg gcgtggtggc gctgtcgcgt       300
     gacctgctgc gcgtgtttcc ctacggcacc cgcgtgacca ttcaggacct ctcgggccgc       360
     tacaacttcg ccggacgcgt gttcatcgtc gaagacacca tgcacccccg caagaccaat       420
     caggtggaca tctggatgcc cacctaccgc gacgccatca gcttcggcac cagcacggtg       480
     cggattaccg ctctgcgctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page