(data stored in ACNUC30630 zone)

EMBL: AE000513.PE475

AE000513.PE475       Location/Qualifiers
FT   CDS_pept        complement(491552..491899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0489"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX26"
FT                   /protein_id="AAF10078.1"
FT                   /translation="MRKGAAGLSSSSSQGVSRRRTFHSILRKRGKGTLAKVSQQATFLR
FT                   KPLFGLFTLIWCSSLPEGPQVVMAGRPEKEFRFRPTNRAKRSERRRSNTARRLPGTLNQ
FT                   ENQGRLAGAPC"
     atgaggaaag gggctgccgg cttgtcgtct tcctcatctc agggagtgag caggagacgg        60
     actttccact cgattctgag aaaaaggggc aaaggtaccc tggcaaaagt gagtcagcag       120
     gcaacttttc tcagaaagcc cttatttgga ctgtttaccc tcatctggtg cagttctttg       180
     cctgaagggc cgcaggtagt gatggcggga aggccggaaa aggagtttcg tttccggccc       240
     acgaaccggg caaagcggtc agagcgccgc cggagcaata cagcgcggcg cctgccggga       300
     actttgaatc aagagaacca aggccgtttg gccggggccc cgtgctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page