(data stored in ACNUC30630 zone)

EMBL: AE000513.PE48

AE000513.PE48        Location/Qualifiers
FT   CDS_pept        46123..47349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:U00096 PID:1787201 percent identity:
FT                   51.40; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09641"
FT                   /db_xref="GOA:Q9RYA1"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA1"
FT                   /protein_id="AAF09641.1"
FT                   /translation="MSAPASSAPRLRLRVSKAAELHIRDGHPWVYESSVREQNREGEPG
FT                   ELAVVYDRRDRFLAIGLYDPFSPLRLRVLHTGMPTQLDDAWWAARLDAALARRAALFGP
FT                   LTAFGDTDGYRVLNGESDGFPGLVVDRYAGVLVMKLYTAAWFPHLRRMLELFAARAPDF
FT                   AVVLRLSRNIAERAADLGLHDGQVIYGELAGDSVVFRESGLRFEAEVRQGQKTGFFLDQ
FT                   RENRRRVEGLSEGRRVLNAFSFSGGFSLYAARGGASEVTSLDISAHALRSAERNFALNP
FT                   ELSAVHKTVQADVFEWLPAGKGSGADYDLVILDPPSLARREAEREGAIRAYGKLAEGGL
FT                   TRLAPGGILVSASCSAHVSAEEFEEAVMSAVRRSGRRWRKLLSSRHAPDHHASFAEAEY
FT                   LKAVFLQMD"
     atgtccgcgc ccgcttcctc tgcccctcgc ctgcgcctgc gggtgtccaa ggccgccgaa        60
     ctccacatcc gcgacgggca tccctgggtg tacgagtcga gtgtgcgcga gcaaaaccgt       120
     gagggcgaac ccggcgaact cgcggtggtg tatgaccgcc gcgaccgctt tctggcgatt       180
     ggtttatacg accccttctc gccgctgcgg ctgcgggtgc tgcacaccgg gatgcccacc       240
     caactcgacg acgcgtggtg ggcggcccgg ctcgatgcgg ccctcgcccg ccgcgccgcg       300
     ctgttcgggc cgctgacggc ttttggcgac accgacggtt accgcgtgct gaacggcgaa       360
     tccgacgggt ttccggggtt ggtggtggac cgctacgctg gcgtgctggt catgaagctc       420
     tacaccgccg cgtggtttcc ccacctgcgc cggatgctgg aactgttcgc cgcccgcgcc       480
     cccgacttcg cggtggtgct gcgcctgagc cgcaacattg cggagcgcgc cgccgacctc       540
     gggctgcacg atggacaggt catctacggc gaactcgcgg gcgactcggt ggtctttcgt       600
     gagtcgggcc tgcgtttcga ggccgaggtc aggcagggcc agaagaccgg ctttttcctc       660
     gaccagcgcg agaaccgccg ccgggtggag ggtctgagcg aggggcggcg ggtgctcaac       720
     gccttttcct tttccggggg cttttcgctc tatgcggcgc gcggcggggc gagcgaagtc       780
     accagcctcg acatcagtgc ccacgccctg cgaagtgccg agcgcaactt cgccctcaac       840
     cccgagctga gcgccgtgca caagaccgtg caggccgacg tgttcgagtg gctgcccgcc       900
     ggcaagggaa gcggcgccga ctacgacctc gtgattctgg acccgccttc gctcgcccgg       960
     cgcgaggcgg agcgcgaggg cgcgattcgg gcgtatggca agctcgccga gggcgggctg      1020
     acgcggctgg cccccggcgg catcctcgtc agcgcctcgt gcagcgccca cgtcagcgcc      1080
     gaggaattcg aggaagccgt gatgtcggcg gtgcggcgca gtggccgccg ctggcgcaaa      1140
     ctgctgagca gccgccacgc gcccgaccac cacgccagct ttgccgaggc agagtacctg      1200
     aaggccgtat ttttgcagat ggactga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page