(data stored in ACNUC30630 zone)

EMBL: AE000513.PE487

AE000513.PE487       Location/Qualifiers
FT   CDS_pept        complement(502484..503593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0501"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /note="similar to SP:Q63707 percent identity: 65.71;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10081"
FT                   /db_xref="GOA:Q9RX14"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RX14"
FT                   /protein_id="AAF10081.1"
FT                   /translation="MYQTVRPLLFRLDAEDAHHLTLRGLELASGVPLLPRLARTLTVPG
FT                   TQGPGDAALRRTLWGQTPSEQTFESPLGLAAGLDKNAQAVPAFTAFGFGFVEVGTVTPL
FT                   AQSGNERPRLFRLPEDEALINRMGFNNGGTAAMHARLAVLTDRAAPVWVNIGKNKVTPN
FT                   EDAAEDYRKCVRALGDLADAFVVNVSSPNTPGLRALQAADDLAALVRAVLDEVEAGRVR
FT                   TLRRPPVLVKLAPDLHPADFEASVGAVLDAGASGLIISNTTLSRGGLSHPNREQAGGLS
FT                   GRPLTDRSTELVRDAYRLTRGQVPIVGVGGVFSAEDAYAKLLAGADLVEVYSALIYRGP
FT                   GLVREINAGLVKLLERDGVRNIADVVGQG"
     atgtaccaga ctgttcgccc gctgctgttc cggctggacg ccgaggacgc ccaccacctc        60
     accctgcgcg ggctggaact cgcttcgggg gtgccgctgc tgccccggct ggcccggacg       120
     ctgacggtgc cgggaacaca ggggccaggc gacgcggcgc tgcggcgcac gctgtggggg       180
     cagaccccct cggagcagac tttcgagtcg ccgctgggcc tcgcggcggg gctggataaa       240
     aacgcgcagg cggtgccggc attcacggca ttcggcttcg gcttcgtgga ggtcggcacg       300
     gtcacgcccc tcgcgcagag cggcaacgag cggccccggc tgttccggct gcccgaggac       360
     gaggcactca tcaatcgcat gggcttcaac aacggcggca cggcggcgat gcacgcccgg       420
     ctcgcggtgc tgaccgaccg ggccgcgccg gtgtgggtca acatcggcaa aaacaaggtg       480
     acacccaacg aagacgccgc cgaggactac cgcaaatgcg tacgggccct gggggacttg       540
     gccgacgcct tcgtggtcaa cgtaagcagt cccaatacac cgggcttacg ggcactgcaa       600
     gcagcagacg acctcgccgc gctggtccgc gccgtgctgg atgaggtgga agcgggccgg       660
     gtccgcaccc tgcgccgtcc gccggtcctg gtcaagctgg cgcccgacct gcaccccgcc       720
     gactttgagg ccagcgtggg cgcggtgctg gacgcgggcg cgagtggcct tatcatctcc       780
     aacaccaccc tgtcccgggg cggcctttcc caccccaacc gcgagcaggc cggagggctc       840
     agtgggcgcc ctcttactga ccgctccacc gaactcgtgc gcgacgccta ccgcctgacg       900
     cggggccagg tgcccatcgt cggcgtcggc ggcgtattca gtgccgagga cgcctacgcc       960
     aagttgctcg ccggggccga tttggtggag gtctactcgg cgctgatcta ccgggggccg      1020
     ggcctggtcc gtgagatcaa cgccggtttg gtcaaactgc tggagcgcga cggcgtgcgg      1080
     aacatagccg acgtggtggg ccagggataa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page