(data stored in ACNUC30630 zone)

EMBL: AE000513.PE49

AE000513.PE49        Location/Qualifiers
FT   CDS_pept        complement(47370..47891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09651"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RYA0"
FT                   /protein_id="AAF09651.1"
FT                   /translation="MPNNTNIDLLLESFRRNGRVNDTLLAALTPADLDLSDGRGGWTVG
FT                   QHLGHLAHFRPGWLSAISPADAEGIPDVIEGTWQKFDLSERDLSKLAEAFRLGDEAALR
FT                   AVQSALAEGRTFPDPHSEGTYQSNPAHFLQHIIVHDSHHRGQVLSLLRLGGRTPEQMDA
FT                   LDDHWAIWRE"
     atgccaaaca atacgaacat cgacctcctg ctcgaatcct tccgccgcaa tggccgcgtc        60
     aacgacacct tgctcgccgc cctgaccccc gccgacctcg acctgtccga cgggcgcggc       120
     ggctggacgg tgggccagca cctcggccac ctcgcccact ttcgccccgg ctggctgagt       180
     gccatttcgc ccgccgacgc cgagggaatc cccgatgtca tcgagggcac ctggcaaaag       240
     ttcgacctct ccgagcgcga cctttccaag ctggccgagg cgtttcgtct gggcgacgag       300
     gcggcgctgc gggccgtgca gtcggcgctg gcggagggcc gcacgtttcc cgacccgcac       360
     agcgagggca cctaccagtc caaccctgct cactttttgc agcacatcat cgtccacgac       420
     agccaccacc gggggcaggt cttgagcctg ctgcgcctcg gcggacgcac gcccgaacag       480
     atggacgcgc tcgacgacca ctgggccatc tggcgcgagt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page