(data stored in ACNUC30630 zone)

EMBL: AE000513.PE491

AE000513.PE491       Location/Qualifiers
FT   CDS_pept        507060..508766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0505"
FT                   /product="5`-nucleotidase family protein"
FT                   /note="similar to PID:1239994 SP:P54602 GB:AL009126 percent
FT                   identity: 53.23; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10084"
FT                   /db_xref="GOA:Q9RX10"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041831"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX10"
FT                   /protein_id="AAF10084.1"
FT                   /translation="MKKNLLLIGASLLLGACSTTPEPSKPEQEKPATTKVTVVGLNDFH
FT                   GNLEPTSFAGVMVPDPKDPTKQVKLTTGGIEVIGGYLDQERAKNANLTFVGAGDLIGAS
FT                   PVTSSLLRDEPSVIGLSKLGMQYSSLGNHEFDQGYKELLRMQNGGCDSNAPDKACKFQN
FT                   PYPRATFSWLGANVEVKATGKPALPAYGIQEIGGARIAFIGAVTKTTPTIVSPDGVADL
FT                   KFLDEAESINKYVPELKAKGVDAIIVLIHEGGVSKDGFDKPACGTLTGPIVNIVNKLDP
FT                   AVDAVISGHTHQGYNCVVNGRTVIQGDYYGHLLQRLDMTIDLQKHKVTDIRAANVVMDP
FT                   NTITKNAEMTALVGRAKSLTDAVKQRAIGSLAAPTISRTTNAAGESALGDLIADSQLAA
FT                   TADRGAVIAFMNPGGIRADLNATGGGTTVTFGDAYAVQPFGNTLVVMDLTGAQIKALLE
FT                   QQFDNPSAGQNRVLQVSKNFTYSYDSTAAAGNRVDPASIKLGGVTLDPAKTYRVTLNSF
FT                   LSTGGDNFTTFASGTNVLQLPNVSDLDALTAYIVAHPGVAGGAQDRIVKLK"
     atgaagaaaa acctgctgct gatcggcgcg tccctgctgc tgggcgcctg ctccacgacc        60
     ccggaaccgt ccaagcctga acaggaaaag cccgccacga cgaaggtcac ggtcgtcggc       120
     ctcaacgact ttcacggcaa cctcgaaccc acctcgttcg ccggggttat ggtgcccgac       180
     cccaaggacc cgaccaagca ggtcaagctg acgaccggcg gcattgaagt catcggcggc       240
     tacctcgacc aggagcgcgc caagaacgcc aacctgacct tcgtgggcgc gggcgacctg       300
     atcggcgcct cgcccgtgac gagcagcctg ctgcgggacg agcccagcgt gatcggcctg       360
     agcaagctcg gcatgcagta cagcagcctg ggcaaccacg agttcgacca gggctacaag       420
     gaactgctgc ggatgcaaaa tggcggctgc gacagcaacg cgcccgacaa ggcctgcaag       480
     ttccagaacc cctacccccg cgcgaccttt agctggctgg gcgccaacgt ggaggtcaag       540
     gcgactggca agccggccct gccggcctac gggattcagg agattggcgg cgccagaatc       600
     gcctttatcg gcgcggtgac gaagaccacc cccaccatcg tcagccccga cggcgtggcc       660
     gacctcaaat tcctcgatga agccgagtcc atcaacaagt acgtgcctga gctgaaagcg       720
     aagggcgtag acgccatcat cgtgctgatt cacgagggcg gcgtgtccaa agacggcttc       780
     gacaagcccg cctgcggcac cctgaccggc cccatcgtga acatcgtcaa caagctcgac       840
     cccgccgtgg acgcggtcat cagcgggcac acccaccagg gctacaactg cgtggtcaat       900
     gggcgcactg tgattcaggg cgactactac ggccacctgt tgcagcgcct cgacatgacc       960
     attgacctcc aaaaacacaa ggtcaccgac atccgcgccg ccaacgtggt gatggacccg      1020
     aacaccatca ccaagaacgc cgagatgacg gcgctggtgg gccgcgccaa gtcgctgacc      1080
     gacgcggtca agcagcgggc catcggctcc ctggcggcgc cgaccatctc gcgcacgacc      1140
     aacgcggcgg gcgaaagcgc actgggcgac ttgattgccg actcgcagct cgccgccacc      1200
     gccgaccggg gcgccgtcat cgccttcatg aaccccggcg gcatccgcgc cgacctgaac      1260
     gcgacgggcg gcggcaccac cgtgaccttc ggggacgcct acgccgtgca gcccttcggc      1320
     aacacgctgg tggtcatgga cctgaccggc gcccagatca aggcgctgct cgagcagcag      1380
     ttcgacaacc cctcggcggg ccagaaccgc gtcttgcagg tcagcaagaa ctttacctac      1440
     agctacgaca gcacggcggc agcgggcaac cgggtggacc cggcgagcat caagttgggc      1500
     ggcgtcacac tcgaccccgc caagacctac cgcgtgaccc tcaactcctt cctctcgacg      1560
     gggggcgaca acttcaccac cttcgcctcg ggcaccaacg tgctgcaact gcccaacgtc      1620
     agcgacctcg acgccctcac ggcctacatc gtcgctcacc ccggcgtggc gggcggcgcg      1680
     caggaccgca tcgtcaaact gaagtaa                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page