(data stored in ACNUC30630 zone)

EMBL: AE000513.PE496

AE000513.PE496       Location/Qualifiers
FT   CDS_pept        515265..515846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0510"
FT                   /product="sensory box protein"
FT                   /note="similar to GB:AE000782 percent identity: 49.17;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10089"
FT                   /db_xref="GOA:Q9RX05"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RX05"
FT                   /protein_id="AAF10089.1"
FT                   /translation="MKSGSIELRWAYVAFGLLAGIDVLAGIRILRRMVWHLEPSAPDAP
FT                   LFILLFLLLHVVLLWLFHRLRNLVRYDQRLRAMYEQELGFAQQLLDASTEGLLMFGPEG
FT                   TITYANRRAGEVMGYAPEALLGQRAQLLVTPEDQAALQEQWVQVWAQPQQVYHLRVYDA
FT                   QGQVRRVQVTASPRWHQGRVVGSFGVVHPE"
     gtgaagtcgg ggagcatcga actgcgctgg gcttatgtgg ccttcgggct cctggcgggc        60
     atcgacgttc tggcgggcat tcgtattctg cgccggatgg tgtggcacct ggagccgtcg       120
     gcgccggacg cgccgctgtt catcctgctg tttttgctgc tgcacgtcgt gctgctgtgg       180
     ctttttcacc ggctgcgtaa cctggtgcgc tacgaccagc ggctacgggc gatgtacgag       240
     caggaactgg gattcgccca gcagttgctc gacgccagca ccgagggcct gctgatgttc       300
     ggtcccgagg gcaccatcac ctacgccaac cgccgcgccg gggaggtgat ggggtacgcc       360
     cccgaagcgc tgctggggca aagagcgcag ctgctggtca cgcccgagga ccaggccgcc       420
     ttgcaggaac agtgggtgca ggtttgggcg cagccccaac aggtctacca cctgcgggtc       480
     tacgacgccc aggggcaggt gcgccgggtg caggtcaccg ccagcccgcg ctggcaccag       540
     ggccgggtcg tgggcagttt cggcgtggtc cacccggaat ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page