(data stored in ACNUC30630 zone)

EMBL: AE000513.PE511

AE000513.PE511       Location/Qualifiers
FT   CDS_pept        525947..526501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0525"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10105"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWZ0"
FT                   /protein_id="AAF10105.1"
FT                   /translation="MNLDRRALSAQVRALRDALDALGLLSPPADVPQVREGEAQINAQR
FT                   LASALSDAAGVLAPYGSSPALSSFHGVLTLAGVVLAEVQAIEPRPLAALGVLMVWASDH
FT                   ARETLGAEAAEQLAQLDTWQIRAAAAPLGESDRGVFLGADAVLRVSSWAAADPDVTAPD
FT                   LTRALLAEAQMLSRPPSAAQA"
     atgaaccttg accgccgcgc cctgagcgct caggtcaggg ccttacgtga cgcgctcgac        60
     gccctgggcc tgctcagccc gcccgctgac gtgccccagg tgcgagaggg agaggcccag       120
     ataaacgccc agcggctcgc ctctgccctg agtgacgcgg cgggggtgct cgcgccctac       180
     ggcagctcgc ccgcgctgag cagttttcac ggggtgctga ccctcgcggg ggtggtgctc       240
     gctgaggttc aggccataga accgcgcccg ctcgcggccc tgggggtgct catggtctgg       300
     gcctctgacc atgcccgcga gacactgggc gctgaggccg ctgagcagct cgcccagctc       360
     gacacgtggc agatacgggc cgccgctgcc ccgctgggcg agtctgaccg gggtgtgttc       420
     ctgggggctg acgcggtgct cagggtgtcg agctgggccg ccgctgaccc tgacgtgacc       480
     gccccagact tgacccgcgc cctactcgct gaggcccaga tgctcagccg cccgcccagc       540
     gctgcccagg catag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page