(data stored in ACNUC30630 zone)

EMBL: AE000513.PE514

AE000513.PE514       Location/Qualifiers
FT   CDS_pept        complement(528994..529986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0528"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY7"
FT                   /protein_id="AAF10110.1"
FT                   /translation="MNGENYETNAAGVLDMPQGQTVERDPRGANAQRHGILSEHVSEGE
FT                   REAYAQHVEQIRASTGAASYLEQRLADRAALALWRLDRVARYEAAQIREAQRSTRAAIA
FT                   EGEGYRGTGNVKRARARLADAAGTSPHLLAAVPGLPEHKAAQHDRAAAHLSRWAGGGSA
FT                   EGLGERDAAHLGAALAGELLDADPPARAGDMVRAMLGRAPRRGEAASVEGHKWTYEPGE
FT                   LPGLLAFYREFWGDEAGEMLGESAEFERGEAAKIRAAQREALSAEADALALAALPGEAE
FT                   AQKVTRYEAHLERVLYRALHDLEAARREREGRDTPGPLRGVLGEQHPSE"
     gtgaacggcg aaaattacga aacaaacgcg gcgggggtgc tcgacatgcc ccagggtcag        60
     accgtcgagc gtgaccccag gggcgcaaac gcccagcggc acgggattct gagcgagcac       120
     gtcagcgagg gcgagcgcga ggcatacgcc cagcacgtcg agcagatacg ggcgagcacc       180
     ggggccgcga gttacttaga gcagcgccta gcagaccggg cggccctcgc cctgtggcga       240
     cttgaccgcg tggcacggta tgaggcggcc cagatacgcg aggcccagcg ctcgacacgg       300
     gccgctattg ctgaggggga gggataccgg ggcaccggga atgtcaagcg ggcacgggcg       360
     cggctcgctg acgcggcggg cacctcgccc catctgctcg cggcggtgcc tgggctgccc       420
     gaacataagg cggcccagca tgaccgggcg gcggcacacc tgagccgctg ggcaggtggg       480
     ggcagcgctg aggggctggg cgagcgtgac gcggcgcacc tgggcgcggc cctcgcgggt       540
     gagctgctcg acgctgaccc cccagcgcgg gcgggtgaca tggtgcgggc catgctgggc       600
     cgcgccccca ggcggggcga ggcggcgagc gtcgaggggc acaaatggac gtatgaaccg       660
     ggcgagctgc cggggctgct cgcgttttac cgcgagttct ggggagatga ggcgggcgag       720
     atgctggggg agtctgccga gtttgagcgc ggggaggcgg caaaaatcag ggccgcccag       780
     cgcgaggccc tcagcgctga ggctgacgcg ctcgccctgg cagcgctgcc cggtgaggct       840
     gaggcccaga aagtcacgcg gtatgaagcg cacctagagc gcgtgctcta ccgtgcctta       900
     catgacctag aggcggcccg ccgcgagcgc gagggcagag acacaccggg gccgctgcgg       960
     ggggtgctgg gcgagcagca ccccagcgag tag                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page