(data stored in ACNUC30630 zone)

EMBL: AE000513.PE515

AE000513.PE515       Location/Qualifiers
FT   CDS_pept        complement(530455..530718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0529"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10111"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWY6"
FT                   /protein_id="AAF10111.1"
FT                   /translation="MTRAKMNAVTWAALDVYAGTVEGQAVPGLGELLSREAPRLGRLKN
FT                   AARSTAEGLGVLTPGGQLTAQGLAAVRAHVERLGLGSAGGER"
     atgacgcggg cgaaaatgaa cgccgtgacc tgggccgcgc tcgacgtgta cgcgggcacg        60
     gtagagggtc aggcggtgcc ggggctgggc gagctgctca gccgcgaggc ccccaggctg       120
     ggcagactca aaaacgcggc ccgctcgacg gctgaggggc tgggggtgct caccccaggc       180
     gggcagctca ccgcccaggg cctcgcggcg gtacgtgccc acgtcgagcg gttagggctg       240
     ggcagcgctg ggggtgagag gtga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page