(data stored in ACNUC30630 zone)

EMBL: AE000513.PE525

AE000513.PE525       Location/Qualifiers
FT   CDS_pept        complement(545914..546243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10123"
FT                   /db_xref="GOA:Q9RWX6"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWX6"
FT                   /protein_id="AAF10123.1"
FT                   /translation="MDFNDIFKQVVPLYTQMNFWLTILGTVLLWYAVSVAFAHVFFGAG
FT                   NRSAVDAANQGMNIALLLLAVALAAGAYFLFKPTDLIYLGAVTLTFLLLAIILHVIFSK
FT                   MGARA"
     atggatttca acgacatttt caagcaagtt gttcctctct atacccagat gaacttctgg        60
     ctgaccattc tgggcaccgt gctgctgtgg tacgcggttt cagtggcgtt cgcgcatgtg       120
     tttttcggtg cgggcaatcg gtcggcggtt gatgcggcca atcagggcat gaacatcgcc       180
     ctgctgttgc tggccgtagc gctggcagcc ggagcttatt tcctcttcaa accgaccgac       240
     ctgatctacc tgggagcagt gaccctgacc ttcctgctgc tggccatcat ccttcacgtc       300
     atcttctcaa aaatgggagc ccgagcctaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page