(data stored in ACNUC30630 zone)

EMBL: AE000513.PE532

AE000513.PE532       Location/Qualifiers
FT   CDS_pept        complement(551157..551534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0546"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10126"
FT                   /db_xref="GOA:Q9RWW9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR041050"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW9"
FT                   /protein_id="AAF10126.1"
FT                   /translation="MQKATEAFTLIELLVVMTIIAILISVLVPSLAGARSKAYDSATTS
FT                   YLRHCASALEISRDDLGVLPSPPPTSCEDPALGVNAQSKPASVKQSQVTVTSSGTAYTI
FT                   SALSQSGKTFTYDQGGFREIP"
     atgcaaaagg ccactgaggc attcacactg atcgagcttc tcgtagtgat gacgataatc        60
     gccattctca tctctgtgct tgtacctagc ctcgcgggcg ccagaagtaa agcttatgac       120
     agcgccacga catcctacct tcgccattgc gcctcagcgc ttgaaatctc acgagacgat       180
     ctaggagttt tgccaagtcc cccaccaacc agttgtgagg atccagcact gggtgtcaat       240
     gcgcagagca agccggcatc ggtcaaacaa tcacaagtta cggttaccag cagtggcact       300
     gcttatacca ttagtgctct ttcacaaagt ggcaagacct ttacctacga tcagggtggc       360
     tttagagaaa tcccttga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page