(data stored in ACNUC30630 zone)

EMBL: AE000513.PE536

AE000513.PE536       Location/Qualifiers
FT   CDS_pept        555381..556133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0550"
FT                   /product="MutT/nudix family protein"
FT                   /note="similar to GB:AE000666 percent identity: 60.20;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10129"
FT                   /db_xref="GOA:Q9RWW5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWW5"
FT                   /protein_id="AAF10129.1"
FT                   /translation="MMAEEGKSGPRPRQGEQPQKRQGPPQGQGTQQAQGGQRRRRRRRT
FT                   PPQQPQNPRPGQVTNTTATPTPAPPKKRGQKRPAGEPRIGVGCIVLRGEEILLVRERGR
FT                   WSLPKGGLEAGELIQDGARRETFEETGLVVELRDLAFIVEFQAETWGHHLQFFYTGREV
FT                   SGTLQPRDPDRDVQEARFIPIRQLREFIRFRPRLVALETWLRERRPRHFVFNLDKEPAM
FT                   LRKRRRVGEGGVVVPVPSLDDADGEPDF"
     gtgatggcgg aggaaggcaa gagcgggcca cggcccaggc agggcgagca gccccagaaa        60
     cggcaggggc ccccgcaagg ccagggcacc cagcaggcgc agggcggcca gcggcggcga       120
     cggcggcggc gcaccccgcc ccagcagccg caaaacccgc gccctggaca ggtcacgaac       180
     accaccgcca caccgacccc ggccccaccc aaaaagcgcg gccagaagcg gccagccggc       240
     gagccgcgca tcggcgtggg ctgcatcgtg ctgcgcggcg aggaaatcct gctggtgcgc       300
     gagcggggac gctggtcgct gcccaagggc gggctggaag cgggcgagct cattcaggac       360
     ggcgcccggc gcgagacttt tgaggaaacc ggactggtcg tcgaactgcg cgacctcgcc       420
     ttcatcgtcg agtttcaggc cgaaacctgg gggcaccacc tccagttctt ctacaccggg       480
     cgcgaggtga gcggcaccct acaaccgcgt gaccccgacc gcgacgtgca ggaggcccgt       540
     tttattccca tccggcaact gcgcgaattt atccgctttc gcccccggct ggtcgcgctc       600
     gaaacctggc tgcgtgagcg ccggccccgg cacttcgtct tcaacctcga caaggaaccc       660
     gccatgctcc gtaagcgccg gcgggtgggg gagggcggcg tcgtcgtgcc agttcccagt       720
     ttggacgatg ccgacggcga gcctgacttt tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page