(data stored in ACNUC30630 zone)

EMBL: AE000513.PE543

AE000513.PE543       Location/Qualifiers
FT   CDS_pept        complement(562484..563317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10138"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV8"
FT                   /protein_id="AAF10138.1"
FT                   /translation="MIAGKAVTKETTHPGFHVQLPVFEGTLGELAAALRSERLLPGEVP
FT                   LLQLTREVLAWAEGVTGLGVTGLGVTGQSPAAFADAHPDLLPTLAGVIALKARLLLPRP
FT                   EPEDVADDWGADDGFDEVLEGVEALAELGSLVAFLAARRQAREGLLPARPAPVTLPRRE
FT                   RPRNPQGSLAKLVRAAQNAVRQVEVPLLARERLSLADALTALRAFGSRLRVFDFWTVHA
FT                   DDWGERTTYFAALLEGVKEGSFQVEQPEMYGDIRVHAAQAETKEETGGEVPSPVS"
     gtgattgcgg gcaaagcggt cacgaaagaa actacccacc ccggctttca cgttcagctt        60
     cccgtcttcg agggcactct gggcgaactc gccgccgcgc tgcgttcgga gcggctcttg       120
     ccgggcgaag tgcccctgct tcagctcacc cgcgaggtgc tggcgtgggc ggagggcgtc       180
     accgggctgg gcgttactgg gctgggcgtt actgggcaga gtcccgccgc ttttgccgac       240
     gcccacccgg acctgctgcc cacgctggcg ggtgtgattg ccctcaaggc gcggttgctg       300
     ctgccccggc ccgaacccga ggacgtagcg gacgattggg gcgctgacga tggcttcgac       360
     gaggtcctgg aaggggtgga ggcactggcc gaactcggct cgctggtcgc ttttctggcg       420
     gcgcggcggc aggcgcggga ggggttgctg cctgcccgcc cagcgccggt cacgcttccc       480
     cggcgcgagc ggccccgcaa tccgcagggg agcctcgcca agctggtacg cgccgcccaa       540
     aatgccgtgc gacaggtcga ggtgccgctg ctggcccgcg aacgcctgag cctcgccgac       600
     gcgctcacgg cgctgcgggc cttcgggtca cggctgcggg tcttcgactt ctggacggtg       660
     cacgcggacg actggggcga gcgcaccacc tatttcgcgg cgctgctcga aggcgtcaag       720
     gaaggcagct ttcaggtcga gcagccagag atgtacggcg acatccgggt ccacgcggcg       780
     caggccgaga ccaaagaaga aacaggcggg gaagttccct cacctgtttc ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page