(data stored in ACNUC30630 zone)

EMBL: AE000513.PE547

AE000513.PE547       Location/Qualifiers
FT   CDS_pept        567840..569021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0561"
FT                   /product="maltose ABC transporter, periplasmic
FT                   maltose-binding protein"
FT                   /note="similar to PID:1850900 GB:AE000512 percent identity:
FT                   56.06; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10141"
FT                   /db_xref="GOA:Q9RWV4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWV4"
FT                   /protein_id="AAF10141.1"
FT                   /translation="MKKALTLLSLALLGQASAATLTVWTHFGENELVWLRDQAKTFEAK
FT                   TKNKVNIVSVPFDDLTTKFLQSAPKGQGPDLIVTQAHDRIGQMAAAGVIEPMDKYVTSK
FT                   TDLDKTAVQAMTYKGKLFGIPMFAESVALIYNKKLVPQAPTTWNALLSAAQSAQKAGNL
FT                   GFVMPLDNAYLTYGFTSAYGGYVFKNNGGTLNTKDIGLGNAGAVKAASFINDLRYKYNL
FT                   IPEGINGDAVKSAFTQGRAAMMISGPWDIDDIRKAGIDFGIAPFPTPPGASGKWSPFVG
FT                   VQGTVMNAYSKNKAVAAQFAKSITTADAQISFNTAGGRIPVSLAARTKLKSNPVVAGFS
FT                   RTISAGTPMPNIPEMGAVWGPWTNAITQVAQKPGQNYSQLLTKAVGEIKGNIK"
     atgaaaaaag cactgaccct tctttctctt gcgttgctcg gccaggccag cgccgcgacc        60
     ttgactgtct ggacccactt cggcgaaaac gaactggtgt ggctgcgtga tcaggccaag       120
     accttcgagg ccaagaccaa gaacaaggtc aacatcgtca gcgtgccctt cgacgacctg       180
     accaccaagt tcctccagag cgcccccaag ggccagggcc ccgacctgat cgtgacccag       240
     gcgcacgacc gcatcggcca gatggcggcg gcgggcgtga tcgagccgat ggacaagtac       300
     gtgaccagca agaccgacct cgacaagacc gccgtgcagg ccatgaccta taagggcaag       360
     ctgttcggga ttccgatgtt cgccgagtcg gtcgctctga tctacaacaa gaagctcgtg       420
     ccccaggccc cgaccacctg gaatgcgctg ctctcggcgg cccagagcgc ccagaaggcg       480
     ggcaacctcg gcttcgtgat gccgctcgac aacgcctacc tgacctacgg ctttaccagt       540
     gcctacggcg gctacgtctt caagaacaat ggcggcaccc tgaacaccaa ggacatcggc       600
     ctgggcaacg cgggcgcggt caaagcggcg agtttcatca acgacctgcg ctacaaatac       660
     aacctgattc ccgaaggcat caacggcgac gcggtcaaga gtgccttcac gcagggccgc       720
     gccgccatga tgatcagcgg cccctgggac atcgacgaca tccgcaaggc gggcatcgac       780
     ttcggcatcg cgcccttccc gacccctccc ggtgcgagcg gcaagtggag cccctttgtc       840
     ggcgtgcagg gcactgtcat gaacgcttat tccaagaaca aggccgtagc ggcgcagttc       900
     gccaagtcga tcaccaccgc cgacgcgcag atttcgttca acaccgcggg cgggcgcatt       960
     ccggtcagcc tcgcggcgcg caccaagctc aagagcaacc ccgtggtcgc cggcttctcg      1020
     cgcaccatca gcgcaggcac cccgatgccc aacattcctg aaatgggcgc ggtgtggggg      1080
     ccctggacca acgcgatcac ccaggtggcg caaaagcccg gtcagaacta ctcccagctc      1140
     ctgaccaagg ccgtgggtga gattaagggc aatatcaagt aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page