(data stored in ACNUC30630 zone)

EMBL: AE000513.PE558

AE000513.PE558       Location/Qualifiers
FT   CDS_pept        580230..581501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0572"
FT                   /product="sporulation protein SpoIID-related protein"
FT                   /note="similar to PID:1652296 percent identity: 53.16;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10150"
FT                   /db_xref="GOA:Q9RWU3"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWU3"
FT                   /protein_id="AAF10150.1"
FT                   /translation="MRKRVRRRWAASLGSRALTIGALAGWALTGWSGPAQALDVRVLIT
FT                   SGPAVTVAVLPVDPAVAAAPASSALSPAPLAPAASVPLRQSWQVGVAGGNLTLDGRGTG
FT                   SPALYLPPAPGSRVELGGQTYRGGVLLRVQNQGVQAINVVDIEDYLRGVVASEMPASWP
FT                   AAALAAQAVIARTYVAARINPAKPYDTCATEQCQVYRGVRGEQPATDAAVAKTAGQVLA
FT                   YGGQPAQTYFSSDSGGYVASSDEVWNTPLPYLVAQPDPYSVSAGGPGAKWSAEVPLARV
FT                   GQLAAGYGVRVGTLSAVEVTRKSASGRAQQLTFRGTGGSRTLEGAEAGGFLRSLGAKSS
FT                   RVSLSRRGTALQVTGAGNGHGVGLSQYGALGMARAGYDHLRMLGFYYPGTTLDLLAGPP
FT                   GAVGQVDRHSLPALALAPAGEGQP"
     atgcggaaac gagtgcggcg gcggtgggcg gcaagtctgg ggagccgggc cctaacaatt        60
     ggggccctgg cgggatgggc gctgaccggg tggagcggcc cggctcaggc gctcgacgtg       120
     cgggtgctga tcaccagcgg cccagcggtc acggtggcgg tgctgcccgt ggacccggcg       180
     gtggctgctg ccccggcgtc ctctgcactg tcgcccgcgc cgctggctcc ggcggcctcg       240
     gtcccgctgc gccagagctg gcaggtgggc gtggctgggg gcaaccttac cctcgacggg       300
     cgcggcaccg gcagcccggc cctctacctg ccgcccgcgc ccggcagccg ggtggagctc       360
     ggcgggcaga cctaccgggg cggcgtgctg ctgcgggtcc agaaccaggg cgtgcaggcc       420
     atcaacgtgg tggacatcga agattacctg cgcggcgtcg tcgcctccga gatgcccgcg       480
     agctggcctg ccgccgcgct ggctgcccag gcggtcattg cccgcaccta cgtggcggcg       540
     cgcatcaacc ctgccaagcc ctacgacacc tgcgccaccg agcagtgtca ggtctaccgg       600
     ggcgtgcgcg gcgagcagcc cgccaccgac gccgccgtcg ccaagaccgc tggtcaggtc       660
     ctcgcctacg gaggccaacc cgcccagacg tatttttcca gcgactcggg cggctacgtg       720
     gcgtcgagcg acgaggtctg gaacactccg ctgccctacc tcgtcgcgca gcccgaccct       780
     tactcagtgt cggcgggcgg gccgggcgcg aagtggagtg ccgaagtgcc gctcgcccgc       840
     gtggggcagc ttgccgccgg atacggcgtg cgggtgggaa cactgagcgc ggtggaagtc       900
     acccgcaaga gcgcttccgg gcgcgcgcag cagctcacct tccggggaac ggggggcagc       960
     cgcacgctcg aaggcgccga ggcgggcggc tttttgcgct cgctgggggc caaaagcagc      1020
     cgcgtgagcc tttcgcgccg gggcacggca ctgcaagtga ccggcgcggg caacgggcac      1080
     ggcgtgggcc tctcacagta cggtgccctc ggcatggcgc gggcaggcta cgatcatctg      1140
     cgtatgttgg gcttctacta tccgggcacg accctggacc tgctcgccgg gccgcccgga      1200
     gcggtgggtc aggtggaccg gcactcactc cctgctctcg cccttgctcc cgctggtgag      1260
     gggcagccgt ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page