(data stored in ACNUC30630 zone)

EMBL: AE000513.PE561

AE000513.PE561       Location/Qualifiers
FT   CDS_pept        complement(585754..588387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0575"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="similar to GB:D10279 SP:P28366 GB:X62035 PID:216334
FT                   PID:48980 percent identity: 67.54; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10155"
FT                   /db_xref="GOA:Q9RWU0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWU0"
FT                   /protein_id="AAF10155.1"
FT                   /translation="MRAGYTYEVMFRVLNKVFDNNKRDVERIIQTVVKPVNALEEETMR
FT                   VENLAEAFMDLRRRVQDGGESLDSLIVPAFALIREAGRRSIGKRHYDTQLIGGAALHQG
FT                   RIAEMRTGEGKTLVATLALAFNALEGKGCHLVTVNDYLARVGMEEMGLLYRTLGLTVGL
FT                   ANRELSPAEKQAAYACDITYVTNSELGFDYLRDNMAQSKEALVLRADTPLHYAIVDEVD
FT                   SILIDEARTPLIISGAAEKATDLYYVFAKLIRRLQKGEPAEPGVRTEPTGDYTIEEKSK
FT                   AVHLTEQGITKIERLLSLKDLYSPENMDKAHMITQAIRARELYHREKDYIVNAEGEVVI
FT                   VDEFTGRSMPGRRYGEGLHQAIEAKEGVKIENENQTLATITYQNFFRLYDKFAGMTGTA
FT                   KTEEKEFLDIYGSDVLVIPTNKPVIRVDSDDLIYRTRMGKYAAVVGEVQEMHATGRPIL
FT                   IGTASIETSEQLSSLLQQAGVQHAVLNAKFEAQEASIIAQAGRSGTVTIATNMAGRGTD
FT                   IMLGGNDEYIIGESIEQQLGVSRYAPEVEAFIKAISREDPAAEQLGMQIPGITLDFIRQ
FT                   AQELHRATVEDRQRVRDLGGLHIVGTERHESRRIDNQLRGRAGRQGDPGSSRFYVSFED
FT                   DLMRLFANDRVVGMMDRLGMDDSQPIEAKMVTGAIEKAQARVEDRNFGIRKQLLEFDNV
FT                   MSKQRDEIYAQRREVLLGPDEDIEETTEGMIGDFVDSQLAAYAPIEVSHEQWDIEQLRS
FT                   AMVEAVPALETFDFESLRVNSPAEAQDRLLSAVADAFDARKEELSPTMMNSLARYVLLQ
FT                   VVDQHWKEHLHGMDVLRQGIGLRGYGQRDPFTEYKFEATNMFNEMIDALKADVTKFIFR
FT                   MQFGGA"
     atgcgggcgg gctatactta tgaggtcatg tttcgtgtcc tgaacaaagt gttcgacaat        60
     aacaaacgcg atgtcgaacg catcatccaa acggtggtga aaccggtcaa tgcgcttgaa       120
     gaagagacga tgcgcgttga gaacctcgcc gaagccttta tggacctgcg ccgccgcgtg       180
     caggacgggg gcgagtccct cgacagcttg atcgtgcccg cttttgccct gatccgcgag       240
     gcggggcgcc gctccatcgg caaacgccac tacgacaccc agctcatcgg cggggccgcg       300
     ctgcaccagg gccgcatcgc cgaaatgcgc accggcgaag gcaaaacgct ggtggcgacg       360
     ctggcgctcg ccttcaacgc gctggaaggc aaaggctgcc acctcgtcac ggtcaacgac       420
     tacctcgccc gcgtgggcat ggaagaaatg ggcctgctct accgcacgct cgggctgacg       480
     gtggggctcg ccaaccgcga actctcgccc gccgaaaagc aggccgctta cgcctgcgac       540
     atcacctacg tcaccaactc cgaactcggc ttcgattacc tgcgcgacaa catggcgcag       600
     tcgaaagaag cgctggtgct gcgcgccgac acgccgctgc actacgccat cgtggacgag       660
     gtggactcga tcctgatcga cgaggcccgc accccgctga tcatctcggg ggccgccgaa       720
     aaagcgaccg acctgtacta cgtgttcgcc aagctcattc gccgcctgca aaaaggtgaa       780
     cccgccgaac ccggcgtgcg caccgagccg accggcgact acaccatcga ggaaaagagc       840
     aaggcggtgc acctgaccga gcagggcatc accaagatcg agcggctgct gtcgctcaaa       900
     gacctctaca gccccgagaa catggacaag gcgcacatga tcacccaggc gatccgcgcc       960
     cgcgagcttt accaccgcga aaaggactac atcgtcaacg cggagggcga agtggtcatc      1020
     gtggacgagt tcaccgggcg ctccatgccg ggccgccgct acggcgaagg gctgcaccag      1080
     gcgattgagg ccaaagaagg cgtcaagatc gagaacgaga accagacgct cgccaccatc      1140
     acctaccaga acttcttccg cctgtacgac aagttcgccg ggatgaccgg caccgccaag      1200
     accgaggaaa aggaattcct cgacatctac ggcagtgacg tgctcgtcat tcccaccaac      1260
     aagccggtca ttcgtgtgga cagcgacgac ctgatctacc gcacccgcat gggcaagtac      1320
     gccgccgtgg tgggcgaagt gcaggagatg cacgccactg ggcggcccat cctgatcggc      1380
     acggcgagca tcgaaacgag cgagcagctc agcagtctgc ttcagcaggc cggggtgcag      1440
     cacgcggtcc tgaacgccaa gttcgaggcg caggaagcga gcatcatcgc gcaggcaggc      1500
     agaagcggca ccgtcaccat cgccaccaac atggcggggc gcggcaccga catcatgctc      1560
     ggcggcaacg acgaatacat catcggcgag agcatcgagc agcagctcgg cgtgagccgc      1620
     tacgcgcccg aagtcgaggc gttcatcaag gccatcagcc gtgaggaccc cgccgccgag      1680
     cagctcggga tgcagattcc cggtatcacg ctggacttta tccggcaggc gcaggagctg      1740
     caccgcgcca ccgtggaaga ccgccagcgg gtgcgcgacc tcggcgggct gcacatcgtg      1800
     ggcaccgagc gtcacgagtc gcgccgcatc gacaaccagt tgcgcgggcg cgccgggcgt      1860
     cagggcgacc ccggcagcag ccgcttttat gtcagcttcg aggacgacct gatgcgcctg      1920
     ttcgccaacg accgtgtggt cggcatgatg gaccgtctcg gcatggacga ctcgcagccc      1980
     atcgaagcca agatggtgac cggcgccatc gaaaaggcgc aggcccgcgt ggaagaccgc      2040
     aactttggga ttcgcaagca actgctcgaa ttcgacaacg tgatgagcaa gcagcgcgac      2100
     gaaatctacg cccagcgccg cgaagtgctg ctcgggccgg acgaggacat cgaggaaacc      2160
     accgagggca tgatcggcga cttcgtggac agccagctcg cggcctacgc gcccattgag      2220
     gtcagccacg agcagtggga catcgagcaa ctgcggagcg ccatggtcga agcggtgccg      2280
     gcgctcgaaa ccttcgactt cgagtcgctg cgcgtcaact cgcccgccga ggcccaggac      2340
     cgcctgctct cggcggtggc cgacgccttc gacgcccgca aggaagagct gagccccacc      2400
     atgatgaaca gcctcgcgcg ctacgtgctg ctgcaagtgg tggaccagca ctggaaagag      2460
     cacctgcacg gcatggacgt gctgcggcag ggcatcggcc tgcgcggtta cggccagcgc      2520
     gacccgttta ccgagtacaa gttcgaggcg acgaacatgt tcaacgagat gatcgacgcc      2580
     ctcaaggcgg acgtgaccaa gttcattttc cggatgcagt tcggcggagc ctga            2634
//

If you have problems or comments...

PBIL Back to PBIL home page