(data stored in ACNUC30630 zone)

EMBL: AE000513.PE569

AE000513.PE569       Location/Qualifiers
FT   CDS_pept        complement(595289..597145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0583"
FT                   /product="cell division protein FtsH"
FT                   /note="similar to GB:M83138 SP:P28691 GB:U01376 PID:146028
FT                   PID:606116 percent identity: 69.22; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10160"
FT                   /db_xref="GOA:Q9RWT2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT2"
FT                   /protein_id="AAF10160.1"
FT                   /translation="MKWWGWALLALTGGLLVLVLSGSPRSQSELNVNDFTQAVRTQQVK
FT                   TADISFQNGTALVTGRLTSGLPYRARTLPADPVLKLGTLEGRGVTVTYLPPPRISVLGA
FT                   LSVLLTLALIGGLIALLVRSRNGGNNDAASSFGKSKAAIISEGQIKLTFADVAGCDEAK
FT                   QDLQEVVEFLRQPEKYHQLGARIPRGVLLVGPPGSGKTLLAKAVAGEAKVPYFSISGSD
FT                   FVEMFVGVGAARVRDLFEQARKASPCIVFIDEIDAVGRKRGMNIQGGNDEREQTLNQLL
FT                   VEMDGFGSGQDVIILAATNRPDVLDAALLRPGRFDRQVVVDAPDVRGREQILRIHSRKK
FT                   PLDVSVDLGVIARRTAGMVGADLENLLNEAALLAAREGRNRITGRDVDEARDRVLMGPE
FT                   RRSMVVREADRKVTAYHEVGHALVAQLLPHSDKAHKLTIVPRGRSLGSALYTPEDRMHH
FT                   TRTALLDRICVALSGHAAEEVIYGEVTTGAQNDFQQATGLARRMVTEWGMSEVGQLALA
FT                   QDNGNYLGFGPQPTNYSDHTAEQIDTAVADILNTQYARAHALLSEHVHVLHRLTDELVA
FT                   RESLSGDELQTVLNGGTLPELPAAVRPEGAPPPEGTLRPEGA"
     atgaaatggt ggggctgggc gctgctggcc ctgaccggcg ggctgctggt gctggtgctg        60
     tcggggtcgc cccgcagcca gagcgaactg aacgtcaacg actttaccca ggcggtgcgg       120
     acgcagcagg tcaaaaccgc cgacatttcc tttcagaacg gcaccgcgct cgtcaccggg       180
     cgcctcacga gtggccttcc ctaccgcgcc cgcacgctgc ccgctgaccc ggtgttgaaa       240
     ctcggcacgc tggaggggcg cggcgtcacc gtcacctacc tgcctccgcc gcgcatcagc       300
     gtgctcggcg ccctgagtgt gctgctcacg ctggcgctca tcggcggact gatcgcgctg       360
     ctcgtccgca gccgcaatgg gggcaacaac gacgcggcga gcagcttcgg caagtcgaag       420
     gcggcgatta tcagcgaggg gcagatcaag ctcacctttg ctgatgtggc gggctgcgat       480
     gaggccaagc aagacctgca agaagtcgtg gagttcctcc gccagcccga gaaataccac       540
     cagctcggcg cccggattcc gcgtggcgtg ctgctcgtcg ggcctcctgg gtcggggaaa       600
     accttgctgg cgaaagcggt cgcaggcgaa gccaaagtcc cttacttctc catctctggc       660
     tcggacttcg tggaaatgtt cgtcggggtc ggtgccgcac gtgtccgtga cctctttgag       720
     caggcccgca aagcttcccc ctgcattgtc ttcattgacg agattgacgc cgtaggccgc       780
     aagcgtggca tgaacattca agggggcaac gacgaacggg aacagacttt gaaccagttg       840
     ctcgtcgaga tggacggttt cgggagtggg caggatgtga ttatcctcgc ggcgaccaac       900
     cggcccgatg tgctggatgc cgcattgctc aggcccggac gatttgaccg tcaggtggtc       960
     gtggacgcgc cggacgtgcg gggccgggaa cagattctgc ggattcactc gcgcaagaaa      1020
     ccactcgacg tgtcggtgga cctcggcgtg attgcccgtc ggacagcggg gatggtgggg      1080
     gccgacctcg aaaacctgct caatgaagcg gcattgctgg cagcaagaga aggcaggaac      1140
     cgcatcaccg ggcgcgatgt agatgaagcg cgggaccgcg tgctgatggg gccggagcgc      1200
     cgcagcatgg tcgtgcgtga agcagaccgc aaagtcaccg cctaccacga ggtcgggcac      1260
     gcgctggtcg cccagttgct cccccactcc gacaaggcgc acaagctgac catcgtacct      1320
     cggggccgca gcctcggctc ggcgctctac acgcctgaag accggatgca ccacacccgc      1380
     acggcgctgc tcgaccgcat ttgcgtggcg ctctccgggc acgcggcgga agaggtcatc      1440
     tacggcgagg tcacgaccgg cgctcagaac gactttcagc aggcgaccgg cctcgcgcgg      1500
     cgcatggtca ccgagtgggg catgagcgag gtcgggcagc tcgccctggc gcaggacaac      1560
     ggcaattacc tcggcttcgg gccgcagccg acgaactaca gcgaccacac cgccgagcag      1620
     atcgacaccg ccgtggccga catcctcaat acccagtacg cccgcgccca cgccctgctc      1680
     agcgagcatg tccacgtcct gcaccgcctg accgacgaac tggtcgcccg cgaaagcctc      1740
     agcggcgacg aattgcaaac ggtattgaac ggcggcaccc tgcccgagtt gcctgccgcc      1800
     gtccgtcccg agggagcgcc gccgcccgag ggcacgctgc ggccggaagg ggcctga         1857
//

If you have problems or comments...

PBIL Back to PBIL home page