(data stored in ACNUC30630 zone)

EMBL: AE000513.PE570

AE000513.PE570       Location/Qualifiers
FT   CDS_pept        complement(597451..598347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0584"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="similar to PID:560524 SP:Q50453 PID:1694867
FT                   GB:AL123456 percent identity: 67.89; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10164"
FT                   /db_xref="GOA:Q9RWT1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWT1"
FT                   /protein_id="AAF10164.1"
FT                   /translation="MTTPDAALPELPDLSQTATLTISCADQPGIVAAVSQFLHNHGANI
FT                   IHSDQHSTDPAGGQFFMRMEFFLGGLDLTREAFERAFEQVVARPLGMDWRLNLASQPKK
FT                   MAVLVSRYDHCFLDLLWRRRRGELNVEIPLILSNHEDLRRDAEMFGIPFHVIPVTKANK
FT                   AEAEAEQVRLMHEAGADFAVLARYMQILSSDFLRGFGRPVINIHHSFLPAFIGANPYRA
FT                   AFNRGVKLIGATSHYVTEELDAGPIIAQDVIPVTHRETPDTLMRMGRDVERQVLARAVK
FT                   AHVEDRVLVYGNKTVVF"
     atgacgacgc ccgacgccgc gcttccggag ttgcccgacc tctcgcagac cgcgaccctc        60
     accatttcct gcgccgacca gccgggcatc gtggccgccg tgtcgcagtt tctgcacaac       120
     cacggcgcca acatcatcca cagcgaccag cacagcaccg acccggcggg cgggcagttt       180
     ttcatgcgaa tggagttttt cctgggcggc ctcgacctga cccgcgaggc gttcgagcgc       240
     gcctttgagc aggtggtggc gcggcccctg ggcatggact ggcggctgaa cctcgcctcg       300
     cagcccaaga agatggcggt gctcgtcagc cgctacgacc actgttttct cgacctgctg       360
     tggcgccggc gccggggcga actgaacgtg gagattccgc tgattctgtc caaccacgag       420
     gacctgcgcc gcgacgcgga gatgttcggc attccctttc acgtcattcc cgtgacgaag       480
     gccaacaagg ccgaggccga ggccgagcag gttcggctga tgcacgaggc gggggccgac       540
     ttcgcggtgc tcgcccgcta catgcagatt ctgagcagcg actttctgcg cggcttcggg       600
     cgcccggtca tcaacatcca ccactcattc ctgcccgcgt tcatcggcgc caacccctac       660
     cgcgccgcgt tcaaccgggg cgtgaaactc atcggcgcga ccagccacta cgtgaccgag       720
     gaactcgacg ccgggccgat tatcgcccag gacgtgattc cggtcaccca ccgcgaaacc       780
     cccgacaccc tgatgcggat gggccgcgac gtggagcggc aggtgctcgc ccgcgccgtc       840
     aaagcgcacg tggaagaccg ggtgctggtg tacggaaaca agacggtggt gttctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page