(data stored in ACNUC30630 zone)

EMBL: AE000513.PE580

AE000513.PE580       Location/Qualifiers
FT   CDS_pept        complement(606138..607556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0594"
FT                   /product="glycogen synthase"
FT                   /note="similar to GB:U00096 PID:1789836 percent identity:
FT                   62.06; identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10170"
FT                   /db_xref="GOA:Q9RWS1"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWS1"
FT                   /protein_id="AAF10170.1"
FT                   /translation="MARGRPCLSAQRLGEEPRVNSTGRYSGPMRVLHLASEVFPFSRSG
FT                   GLGDVLGALPAVQARLGEDAEVTVLSPWYASLQGEPQELWRGEAWGEQAWLGELRQDGV
FT                   RYLFLGLNEFQRPGLYHPDDVERFCAFGRAALPALDAVGVTPDVLHGHDWQAGLVVAHA
FT                   RLRGLRTAFSVHNLQYQGRWNLHEAAGWTGLPDWTFGPDGVEFFGDLNLMKAGLNFAGH
FT                   VTTVSPTYAQEITTPQYGEGLEGLLVRLTHEGRLSGILNGLDQDRWNPRTDPDIAAYSD
FT                   PAGKAGAVKALRQEFGLDDAPILATVSRLADQKGMDLLITALPELVRDWNVVVLGGGDP
FT                   LLEAALTGWANHPRVAFASGMNEPLAHRIYAGAHAFAMPSRFEPCGLSQLIAMRYGTLP
FT                   IVRETGGLADTVPPEVGFRFADATAPAFLQACREAQAAFQDPAQWQTRATRAMSLDFSW
FT                   DGPARQYLELYRGL"
     ttggcgaggg gccgcccgtg cctgtccgct cagcgacttg gcgaggaacc ccgtgtgaac        60
     agcaccgggc ggtacagtgg gcccatgcgt gtgctgcatc tcgcctccga ggtcttcccc       120
     ttttcccgct ccggtggcct gggcgacgtg ctgggagcgc tgcccgctgt gcaggcgcgg       180
     ctgggcgaag acgcagaagt cacggtcctc tcgccgtggt acgcctcctt gcagggcgag       240
     ccgcaggaac tctggcgcgg ggaagcctgg ggcgagcagg cgtggctggg cgaactccgt       300
     caggacggcg tgcgctacct ctttctcggc ctgaacgagt ttcagcgccc cggcctctat       360
     caccccgacg acgtagagcg cttctgcgcc ttcgggcgag cggcgctccc ggcactggac       420
     gcggtgggcg tgaccccgga cgtgctgcac gggcacgact ggcaggcggg actggtggtc       480
     gcccacgccc ggctgcgtgg cctgcggacc gccttttcgg tccacaacct gcaataccag       540
     ggccgctgga acctgcacga agcggcgggc tggaccgggc tcccggactg gaccttcggg       600
     cccgatgggg tggagttttt cggcgacctc aacctgatga aagcgggcct gaactttgct       660
     gggcacgtca ccaccgtcag ccccacctac gcgcaggaaa tcaccacgcc gcaatacggc       720
     gaggggttgg aagggctgct ggtgcggctg acccacgagg gccgactctc gggcatcctc       780
     aacgggctcg accaggaccg ctggaacccg cgcaccgacc ccgacatcgc cgcctacagc       840
     gacccggcag gcaaggcagg ggccgtgaag gcgctgcggc aggaattcgg cctggacgac       900
     gccccgattc tggcgacggt cagccgcctc gccgaccaga agggcatgga cctgctgatt       960
     acggcgctgc ccgaactggt gcgcgactgg aacgtggtgg tgctcggcgg cggcgacccg      1020
     ctgctggaag ccgcgctgac cggctgggcc aaccaccccc gcgtcgcctt cgcttcgggc      1080
     atgaacgagc cgttggcgca ccgcatctac gccggcgccc acgcgtttgc catgcccagc      1140
     cgcttcgagc cgtgcggcct ctcgcagctc atcgccatgc gctacggcac cctgcccatc      1200
     gtgcgcgaaa ccggcggact ggccgacacc gtgccgcccg aagtcggttt ccgctttgcc      1260
     gacgccaccg cgcccgcctt cctgcaagcc tgccgcgagg cccaggccgc ctttcaggac      1320
     ccggcgcagt ggcagacccg cgccacccgc gccatgtcat tggatttctc ctgggacggt      1380
     ccggcacggc aatacctgga actttaccgg gggctgtaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page