(data stored in ACNUC30630 zone)

EMBL: AE000513.PE587

AE000513.PE587       Location/Qualifiers
FT   CDS_pept        612425..614140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0601"
FT                   /product="DNA primase"
FT                   /note="similar to SP:P33655 GB:Z23080 PID:580959 percent
FT                   identity: 61.27; identified by sequence similarity;
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10180"
FT                   /db_xref="GOA:Q9RWR5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWR5"
FT                   /protein_id="AAF10180.1"
FT                   /translation="MVGEYVRLTPAGKGRLKGLCPFHKEKTPSFQVDTEKGYYHCFGCK
FT                   ASGDVFGFVQQMEHLSFGDALRKLADRAGIQIDAKYGEKVSRDLYEVNAFALDYFRSHL
FT                   PGPALDYLRGRGLSDETIAAFELGYAPDGWDGLLKLARTKGVSEKQLLEAGLLTENPEN
FT                   GRVYDRFRGRVMFPIRDHLGRLVGFGGRVLDDSKPKYLNTPETAAFKKGELLYGLDKAR
FT                   SGLGGGAELVVVEGYMDVISMHQHGFTGAVASLGTALTAEHAQLLERLGAQSIVLMFDQ
FT                   DGAGLKATLAGLDQVIGAKFRVRATSVPSGKDPADALLAGDDAGIREALAGGLDEVKYR
FT                   VQAATEKYGVDTNEGKRRVLMELLPRMQNLDPLDAIAQDMRGAACELLGIRPEALLDWI
FT                   TSKAKRRTLTDTHLAGMSQSSGEEEHELALLRQLLVDPSLLAKLDGSLPWRNEAVRKVM
FT                   LAAQGARSPDDILDIFRGQPEEQLLIRLMFEGRDSGSLSRASSQEYEQKVTTYAAHAVD
FT                   DIQVTLNIDALKTEVDLLKKQLLSTPPAEQLALLSQIQELQRAIEAEKRARRGS"
     gtggtgggcg aatacgtgcg cctcaccccc gccggaaagg ggcggctcaa gggcctgtgc        60
     ccctttcaca aggaaaagac cccctcgttt caggtggaca ccgaaaaggg ctactaccac       120
     tgcttcggct gcaaggcgag cggcgacgtg ttcggcttcg tgcagcagat ggagcacctg       180
     agcttcggcg acgcgctgcg caagctcgcc gaccgcgccg gaatccaaat tgacgccaag       240
     tacggcgaga aagtcagccg cgacctgtac gaggtcaacg ccttcgcgct cgattacttc       300
     cgctcgcatc tgccggggcc cgcgctcgac tacctgcgcg ggcgggggct gagcgacgag       360
     accattgccg cctttgaact cggctacgcg cctgatggct gggacggcct gctcaagctc       420
     gcccgcacca agggcgtctc cgaaaagcaa ctgctggaag ccgggctgct caccgagaac       480
     cccgaaaacg ggcgcgtcta cgaccgcttc cggggccgcg tcatgtttcc catccgcgac       540
     catctggggc ggctggtggg cttcggcggg cgcgtactcg acgactccaa acccaagtac       600
     ctgaacaccc ccgaaaccgc cgccttcaaa aagggcgaac tgctctacgg gctcgacaag       660
     gcccgcagcg gcctgggagg gggcgccgag ctggtggtcg tcgaagggta catggacgtg       720
     atttccatgc accagcacgg ctttaccgga gccgtcgcca gcctgggcac cgcgctgact       780
     gccgaacacg cgcagcttct cgaacggctc ggcgcccaga gtatcgtcct gatgttcgac       840
     caggatggcg cgggcctcaa ggcgacgctc gccgggctcg accaggtgat cggggccaag       900
     ttccgcgtgc gggcgacctc ggtgcccagt ggcaaggacc ccgccgacgc gctgctcgcg       960
     ggcgacgacg cgggcatcag ggaagcgctc gccggggggc tcgacgaggt caagtaccgc      1020
     gtgcaggccg ccaccgagaa gtacggcgtg gataccaacg agggtaaacg ccgcgtcctg      1080
     atggagctgt tgccgcgcat gcagaacctc gacccgctcg acgccatcgc gcaggacatg      1140
     cggggggcgg cgtgcgagtt gctcggcatc cggcccgagg cgctgctcga ctggatcacg      1200
     tccaaggcca agcgccgcac cctgaccgac acccacctcg cgggcatgag ccagagcagc      1260
     ggcgaggagg aacacgagct ggcgctgctg aggcaactgc tggtggaccc ctcgctgctc      1320
     gccaaactcg acggctcgct tccctggcgc aacgaggcgg tgcgcaaggt gatgcttgcc      1380
     gcccagggtg cgcgcagccc cgacgacatt ctggacattt tccggggcca gcccgaggaa      1440
     cagcttctca tccgcctgat gttcgagggc cgcgactcgg gcagcctctc gcgggcatcg      1500
     tcgcaggagt acgagcagaa ggtcacaacc tacgccgccc acgcggtgga cgacattcag      1560
     gtcacgctga acatcgacgc cctgaaaacc gaggtggacc tgctgaaaaa gcaactgctc      1620
     agcaccccgc ccgccgagca gctcgccctg ctgagccaga ttcaggagtt gcagcgcgcg      1680
     attgaagcgg agaagcgggc gcggcgggga agctaa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page