(data stored in ACNUC30630 zone)

EMBL: AE000513.PE592

AE000513.PE592       Location/Qualifiers
FT   CDS_pept        617795..618157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0606"
FT                   /product="chaperonin"
FT                   /note="similar to PID:1066157 percent identity: 85.26;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10185"
FT                   /db_xref="GOA:Q9RWR0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWR0"
FT                   /protein_id="AAF10185.1"
FT                   /translation="MKALGGKKLAGTTLRHSISLTGGPHMLKPLGDRVLVEIIEEAEQK
FT                   TAGGLYVPDSAKEKSQRGKVVAVGTGKTLDNGTKVAMEVKEGDTVYFAKYGGTEVSLEG
FT                   KNYSLLSERDLLAIVE"
     ttgaaggcgc tgggcgggaa aaagctcgcc ggcacgactc tccgccattc catctcactc        60
     acaggaggac cccacatgct gaaaccttta ggcgaccgcg ttctggttga aattatcgaa       120
     gaagccgagc agaagactgc cggcggcctg tacgtccccg attccgccaa ggaaaagagc       180
     cagcgcggca aagtcgttgc cgtcggcacg ggtaagaccc tggacaacgg caccaaagtc       240
     gccatggaag tcaaggaagg cgacaccgtg tacttcgcca agtacggcgg caccgaagtc       300
     agcctcgaag gcaagaacta cagcctgctg agcgagcgcg acctgctcgc cattgtcgag       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page