(data stored in ACNUC30630 zone)

EMBL: AE000513.PE598

AE000513.PE598       Location/Qualifiers
FT   CDS_pept        623135..624754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0612"
FT                   /product="arginine utilization protein RocB, putative"
FT                   /note="similar to GB:X73124 SP:P39635 PID:414001
FT                   GB:AL009126 percent identity: 50.58; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10189"
FT                   /db_xref="GOA:Q9RWQ4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ4"
FT                   /protein_id="AAF10189.1"
FT                   /translation="MTIDVSARDVTIELVRAASVTNTAGEQAFPETLLRVLGRLPYFQA
FT                   HPEDLWTQPIENDPYGRRNVYALVRGDGPAGVVLTGHYDVVSAANYGPHADVAFDPEAL
FT                   LPRLIADLRVNARSEAERRALHDLESGDFLPGRGALDMKAGLAAGIAALAEFAARPARR
FT                   GNVLFAAVADEEVSSHGARQAAPELRALAEREGLDWRLVINLDATGDNGDGSAGQAVYL
FT                   GTAGKLLVSAFVVGVDTHAGYSLDGVNVNFLASELTRAFEFSPELTDRSAGIMGTPPTV
FT                   LRQQDLKTYYDVTTPARAWLCVNALTHGLDAATVLDRFKASAQAALDDALDTLRRRAEA
FT                   LGETRSAAHGATPLVLTYADLLERARQQVPDLDAALTAYDAGLDPQLDLPTRSAHLTGW
FT                   LWDASGLLGPAAVLGFASLHYPNTTLDSRNPTEAQALDLVRATLREKGAELGVTISERP
FT                   IFTGISDMSWFGTADSADIAAVNANTPAPAAHIHAPPAGLPCINLGPWGRDYHQWLERA
FT                   YAPYSFGTLPRLVSALTEAFLR"
     atgacaattg atgtttcggc ccgtgacgtg accatcgaac tcgtgcgggc ggccagcgtg        60
     acgaatacag cgggtgagca ggcgttccca gagacccttt tgcgggtgct ggggcgcctg       120
     ccttattttc aggcgcaccc cgaagacctc tggacacagc ccatcgaaaa cgacccctac       180
     ggacggcgca acgtgtacgc gctggtgcgc ggggacggcc cggcgggggt ggtcctcacc       240
     gggcattacg acgtggtatc ggcggcgaac tatggtcccc acgcggacgt ggccttcgac       300
     cccgaggcgc tgctgccccg gctgatcgcc gacctgcgcg tcaacgcccg cagcgaggcc       360
     gagcggcgcg ccctgcacga cctcgaaagc ggcgatttct tgcccggacg cggcgccctg       420
     gacatgaaag cggggctggc ggcgggcatc gcggcgctcg ccgagttcgc ggcgcgtccg       480
     gcgcggcggg gcaacgtgct gttcgcagcg gtggccgacg aggaagtcag ctcgcacggg       540
     gcccggcagg cggcgccgga gctgcgggcc ctggccgagc gggaaggtct ggactggcgg       600
     cttgtcatca acctcgacgc cacgggagac aacggcgacg gcagcgcggg gcaggcggtc       660
     tacctgggca cggcgggcaa gctgctggtc tcggccttcg tggtcggcgt ggacacccac       720
     gcgggctact cgctcgacgg cgtcaacgtc aatttcctgg caagcgagct gacgcgggcc       780
     ttcgaattca gccccgagct gaccgaccgc agcgccggca tcatgggcac gccgcccacc       840
     gtgctccggc aacaggacct caagacctat tacgacgtga ccacgcccgc ccgcgcctgg       900
     ctgtgtgtca acgcgctgac gcacgggctg gacgctgcca ccgtgctgga ccgcttcaag       960
     gcgagcgcac aggcagcgct ggatgacgcc ctggacaccc tgcgccgccg cgccgaggct      1020
     ctgggcgaaa cgcggagcgc cgcgcacgga gccacgccac tggtcctcac ttacgcagac      1080
     ttgctagagc gagcgcggca gcaggtgccc gacctcgatg ccgccctcac cgcctacgac      1140
     gcgggcctcg acccacagct cgacctgccg acccgcagcg cccatctcac cggctggctg      1200
     tgggacgcct cggggctgct cggcccggcg gcggtgctgg gcttcgcgtc gctgcactac      1260
     cccaacacca cgctcgactc ccggaatccc accgaggcgc aggccctcga cctcgtgcgc      1320
     gccaccctgc gcgagaaggg cgcggaactc ggcgtcacca tcagcgagcg gcccatattt      1380
     accggcatca gcgacatgag ctggttcggc accgccgact ctgccgacat cgccgccgtc      1440
     aatgcgaaca cgcccgcgcc cgccgcccac atccacgcgc cgcccgccgg cttgccctgc      1500
     atcaacctcg gaccctgggg ccgcgactac caccagtggc tggagcgggc ctacgcgccc      1560
     tacagcttcg gcacgttgcc ccggctggtg tcagcgctca ccgaggcttt tttgcgttga      1620
//

If you have problems or comments...

PBIL Back to PBIL home page