(data stored in ACNUC30630 zone)

EMBL: AE000513.PE6

AE000513.PE6         Location/Qualifiers
FT   CDS_pept        complement(6162..6944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GB:AE000782 percent identity: 64.04;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09599"
FT                   /db_xref="GOA:Q9RYE3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RYE3"
FT                   /protein_id="AAF09599.1"
FT                   /translation="MKRLRSGGGDKRAQHPHAVAPPHSYSGVPGGNLMLKIRSLGHSTF
FT                   FLDDGTHRLLIEPFLEGNPRCPVTLGEVQSWQPSAVLISHAHGDHWGNALDFGRAGVPI
FT                   IATAEIAGYAGAHGANNAVGMNIGGTYRAEWGSVSLTPAWHSSSFPDGTYGGMPTGLVI
FT                   EFGGQRLYFAGDTALFSDMRLIGDRELDLAFLPIGDHYTMGPEEAGRTLDLLRPRVAIP
FT                   MHYATFPALTGDPAVFRTEGERRGVEVRVLDPGETTEL"
     atgaagcggc tgagatcagg gggaggggac aaaagggcac aacatcccca cgctgtcgcc        60
     cctcctcatt catactcagg agttccagga ggcaacctca tgctcaagat ccgttctctc       120
     ggccacagca ctttctttct cgatgacggg acgcaccgtc tgctcatcga accctttctc       180
     gaaggcaacc cgcgctgccc ggtgaccctc ggcgaagtgc agtcgtggca gccgagcgcc       240
     gtgctcatca gccacgccca cggcgaccac tggggcaacg ccctggattt cggacgggcg       300
     ggcgtgccga tcatcgccac cgccgagatc gccgggtacg ccggagcgca cggcgccaac       360
     aacgccgtcg gcatgaacat cggcggcacc taccgcgccg agtggggcag cgtttccctg       420
     acccccgcgt ggcactcgag ctcctttccc gacggcacct acggcggaat gcccacgggt       480
     ctggtcatcg agttcggcgg ccagcgcctg tatttcgcgg gcgacaccgc gctgttttcc       540
     gacatgcgcc tgatcgggga ccgcgaactc gacctcgcgt tcctgcccat cggcgaccac       600
     tacaccatgg ggccggaaga ggccgggcgc acgctggact tgctgcgtcc gcgcgttgcc       660
     attcccatgc actacgcgac tttcccggcc ctgaccggcg accccgccgt cttccgcacc       720
     gagggcgaac ggcgcggcgt ggaggtccgg gtccttgacc ccggcgagac gaccgagctg       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page