(data stored in ACNUC30630 zone)

EMBL: AE000513.PE600

AE000513.PE600       Location/Qualifiers
FT   CDS_pept        complement(625745..626464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0614"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to SP:P45944 PID:1217881 PID:1303774
FT                   GB:AL009126 percent identity: 45.70; identified by sequence
FT                   similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10191"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ2"
FT                   /protein_id="AAF10191.1"
FT                   /translation="MQPTRGPVSARAAELNAAFREKILAPDFSCVAAKASMNTSAYALG
FT                   VYGELGSLSATXGLAHDLARFVQDQDDLGSDFTSFIATFDSPEGMTEPQFEERLWQQLR
FT                   ALHQLDTAPYSEEVSADPHSNKFGFSFAGRGFFIIGLHPGSSRVARAFPAPALVFNAHR
FT                   QFQKLRDTGRFERMQQTIRSRELKLQGSLNPNLANYGEAPEARQYSGRAVEPGWVAPFP
FT                   NTPTAGRCPFGFGDGAD"
     ttgcagccca cccggggccc ggtgtcggcc cgcgccgccg aactgaacgc ggccttccgc        60
     gaaaaaatcc tggcccccga cttttcctgc gtggcggcca aggcgtccat gaacaccagc       120
     gcctacgcgc tcggcgtgta cggcgaactc ggcagcctga gcgccacgyt cggcctcgcg       180
     cacgacctcg cccgcttcgt gcaagaccag gacgacctcg gcagcgattt cacgtccttc       240
     attgccactt tcgactcgcc cgaaggcatg accgagccgc agttcgagga gcggctctgg       300
     cagcagctcc gcgccctgca ccagctcgac acggcgcctt acagcgagga agtcagcgcc       360
     gacccgcaca gcaacaagtt cggcttttct ttcgccgggc gcgggttttt catcatcggc       420
     ctgcatcccg gcagcagccg cgtggcccgc gcgtttccgg cgcccgcgct ggtgttcaac       480
     gcccaccgtc agtttcagaa actgcgcgac accgggcgct tcgagcggat gcagcagacc       540
     atccgcagcc gcgagctgaa gttgcagggc agcctcaacc ccaatctcgc caattacggc       600
     gaggcgcccg aagcccggca atactcaggc cgcgcggtgg agcccggctg ggtggccccg       660
     tttcctaaca ctcccacagc gggccgctgc cctttcggct tcggcgacgg ggcagactga       720
//

If you have problems or comments...

PBIL Back to PBIL home page