(data stored in ACNUC30630 zone)

EMBL: AE000513.PE601

AE000513.PE601       Location/Qualifiers
FT   CDS_pept        626751..627704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0615"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="similar to GB:L04470 SP:Q04778 PID:142469
FT                   PID:1929339 GB:AL009126 percent identity: 59.74; identified
FT                   by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10192"
FT                   /db_xref="GOA:Q9RWQ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RWQ1"
FT                   /protein_id="AAF10192.1"
FT                   /translation="MELRHLRHFVALAEEEHFGRAAERVFVVQQALSSSIRNLEEEVGV
FT                   QLVTRTTRRVQLTPAGEEFLIGARATLAQAAQTVERARRAAQGEVGRLTVGFVSGLAFG
FT                   GLPEIVRRFRELYPAVSVDLRELTAGEQEAALRGGQIDVGLLLLPVRDPALASRPLWRL
FT                   PLVAALPAAHPLASRTTLRIGDLSQEDFVFFPRYLRATYFDQVMHWCADAGFTPHVVQE
FT                   AIEIPTLLSLVAAGVGVFLPIEFFARLALPGVVYRPLEGAPVIEIVAVWRRAAAGEQST
FT                   RPTVQAFLQVAERVLSGENGAGEATPLPVLPTEPPR"
     atggaactgc gacacctgcg ccacttcgtc gctctggccg aggaagaaca cttcgggcgg        60
     gccgccgagc gcgtctttgt ggtgcagcag gcgctgagca gctcgattcg caacctcgaa       120
     gaagaagtgg gcgtgcagct cgtgacccgc accacccggc gcgtgcagct caccccggcg       180
     ggcgaggaat ttctgatcgg ggcgcgggcc accctggcgc aggcggcgca gacggtggag       240
     cgggcgcgcc gggccgcgca gggcgaggtg gggcggctga ccgtgggctt cgtcagcggg       300
     ctggcgttcg ggggcctccc ggaaatcgtg cggcgctttc gggagctgta cccggcggtc       360
     agtgtggacc tgcgcgaact gacggctggc gagcaggaag cggcgctgcg tggcgggcag       420
     atcgacgtgg ggctgctgct gctgccggtg cgtgacccag ccctcgcgtc gcggcccctg       480
     tggcgcctgc cgctcgtggc ggccctgccc gccgcgcacc cgctggcgtc gcggaccacc       540
     ctgcgaatcg gcgacctcag ccaggaggac ttcgtgtttt ttccgcgcta cctgcgcgcc       600
     acctatttcg accaggtcat gcactggtgc gccgacgcgg gctttacgcc ccacgtggtg       660
     caggaagcca tcgagattcc caccctgctc tcgctggtgg cggcgggggt gggagtcttc       720
     ttgcctatcg agttttttgc gcgcctggcg ctgccggggg tggtctaccg cccgctcgaa       780
     ggcgccccgg tgatcgagat cgtggcggtg tggcggcgag cggcggcagg cgaacagtcc       840
     acccggccca ccgtgcaggc cttcttgcag gtggccgagc gggtgctgag cggggagaac       900
     ggcgcgggcg aggcgacccc gctgcccgtt ctgcccaccg agccgcccag gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page