(data stored in ACNUC30630 zone)

EMBL: AE000513.PE605

AE000513.PE605       Location/Qualifiers
FT   CDS_pept        complement(632357..632797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to GP:2959336 percent identity: 65.54;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAF10198"
FT                   /db_xref="GOA:Q9RWP7"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RWP7"
FT                   /protein_id="AAF10198.1"
FT                   /translation="MRLHLITVGEPKLAYARSGWDEYEKRLRRYHKVQVSRVSGKTQQA
FT                   ESEAILKAAGKSPLILLDPRGKQFSSEKLSEYLDAEALGGHGELAFAIGGPDGHTDALR
FT                   GQAKLLWSLGELTLPHDLAMLVLVEALYRAATISAGEPYHRG"
     atgcgcctgc acctgattac tgtcggagaa cccaagctcg cctacgcccg cagcggctgg        60
     gacgagtacg aaaagcggct gcggcgctac cacaaggtgc aggtcagccg ggtcagcggc       120
     aagacgcagc aggccgagag cgaggcgatt ctgaaggccg ccggcaaaag cccgctgatt       180
     ttgcttgacc cgcgcggcaa gcagttcagc agtgaaaaac tcagtgaata tctggacgcc       240
     gaagcgctcg gcgggcacgg cgaactcgcc ttcgccatcg gcgggccgga cggccacacc       300
     gacgcgctgc gggggcaggc taagttgcta tggagcctcg gcgagctgac cttgccgcac       360
     gacctcgcca tgctggtgct ggtggaggcc ctgtaccgcg ccgccaccat ctcggcaggc       420
     gagccctacc accggggcta a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page