(data stored in ACNUC30630 zone)

EMBL: AE000513.PE64

AE000513.PE64        Location/Qualifiers
FT   CDS_pept        60568..63186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DR_0065"
FT                   /product="ATP-dependent helicase, putative"
FT                   /note="similar to GB:AE000666 percent identity: 52.53;
FT                   identified by sequence similarity; putative"
FT                   /db_xref="EnsemblGenomes-Gn:DR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAF09654"
FT                   /db_xref="GOA:Q9RY85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9RY85"
FT                   /protein_id="AAF09654.1"
FT                   /translation="MLPARSPYARLELFLRDILGAGATLLHEEEVREAQTVSAASLGWS
FT                   QAVQRGFGFSEVYAHQADTYRLMHAGKNVIITTPTASGKTGAFFPAVFERLEQKPEATA
FT                   LFVYPLVALGQDQRDKLRAFREKGGFGWDIAAFHGSAQPGDVFTGNVRMVTATPDKLHW
FT                   ALDKPAVRDFLRRLEFIVLDEAHTYRGGFGSEVAGMLRRLLDLARALGANPQVVLSTAT
FT                   IGNPAEFARELVGVEAEQVGESGAARHGKRYYLADHRGQPRRFWDSVVSASIHHDLKVL
FT                   AFFRGRSRAARLYSTYRSQSRYAPHVHLYMAGTSDREGRLSEFRRTKSGVMFATNALEA
FT                   GVDIGDLEVVIIDGYPGSRMAFRQMAGRAGRVAPGLVLYLPALNEQGVPQPVDAFYSNL
FT                   GNFRELLTGPLEKAVVEAGNPYLSPRHQARRNAEFRAAGLPALPRPGPSYWNLRGEGSA
FT                   TFAVIEEKDWQERGLRAFDAPLESPSQHYALTEKHEGAVFTLDGQGYKVLRWEDTARGT
FT                   AIIVEKHLAADLFTRGLYSTQVRPVKMGEWVRRGPLAYRHGEVVVQRIYTGYTVMRQVF
FT                   ERVCTGCDRDPAPLERVCANCGGRIQDRMQDQKLAEQLYDDPIELPPFRTSALEVGIDP
FT                   ARTERPTAVAHTLKHLLMKLIPERVACDEGDLAGAFREGHDAYFFLYDDWRGGLGVSRR
FT                   AFEQMDDLLRRAHVLATKTCCTSPHGCFECIAVSRCFSPLLPSGERRPTDKQATALFLQ
FT                   ELLGLQPAPAEAEVIPDVAPALPGDWPQQARELLDLHGLSLPEVSARLGIPSRELQRAV
FT                   NTTAPLRLAHAKFGEGILTQGSGSGDAREVLVYFPGHGYKRLLVKYAGLSVVQGQAAGR
FT                   R"
     atgctgcccg cccgctcccc ctacgcccgc ctggaactgt ttttgcggga catcctgggg        60
     gcgggggcca cgctgctgca cgaggaagaa gtgcgcgagg cgcagacggt gagtgcggcg       120
     agcctcggct ggtcgcaggc cgtgcagcgc ggcttcggct tttccgaagt ctacgcccac       180
     caggccgaca cctaccggct gatgcacgcg ggcaaaaacg tcatcatcac cacgccgacg       240
     gcgagcggca agacgggcgc ctttttcccc gcagtgttcg agcggctgga gcaaaagccc       300
     gaggccaccg ccctgttcgt ctatcccctc gtggcgctcg ggcaggacca gcgcgacaaa       360
     ctgcgggcct tccgggaaaa gggtggcttc ggctgggaca tcgccgcctt tcatggctcg       420
     gcgcaaccgg gcgacgtatt taccggcaac gtgcggatgg tgaccgccac gcccgacaag       480
     ctccactggg cgctcgacaa gcccgccgta cgcgactttc tgcggcggct ggaatttatc       540
     gtgctcgacg aggcgcacac ctaccggggc ggcttcggct cggaggtggc ggggatgctg       600
     cggcgcctcc ttgacctcgc gcgcgcacta ggggcgaacc cgcaggtcgt gctgtccacc       660
     gccaccatcg gcaaccccgc cgaatttgcc cgcgaactcg tgggggtgga ggccgagcag       720
     gtcggcgagt cgggcgcggc gcggcacggc aagcgctatt acctcgccga ccaccggggg       780
     cagccccgcc gcttctggga cagcgtggtg agcgccagca ttcatcacga cctcaaggtg       840
     ctcgcctttt tccggggccg ctcacgggcg gcgcggctgt actccaccta ccgctcgcag       900
     tcgcgctacg ccccgcacgt tcacctctat atggccggca cgagtgaccg cgaggggcgc       960
     ctcagcgagt ttcgccgaac gaaaagtggt gtgatgttcg ccaccaacgc gctcgaagcc      1020
     ggggtggaca tcggcgacct cgaggtggtc atcatcgacg gctaccccgg ctcgcgcatg      1080
     gccttccggc agatggcggg gcgggcgggc cgcgtggcgc cggggctggt gctctacctc      1140
     ccggcgctga acgaacaggg cgtgccgcag ccggtagacg ccttttattc caacctcggc      1200
     aacttccgcg aactgctcac cgggccgctg gaaaaggcgg tggtggaggc gggcaacccc      1260
     tacctgtccc cccgccatca agcgcggcgc aacgccgaat tccgtgcggc gggattgccc      1320
     gcgctgccgc ggccggggcc gagctactgg aacctgcgcg gcgaggggag cgcgaccttc      1380
     gccgtcattg aggaaaaaga ctggcaggag cgcgggctgc gggccttcga cgcgccgctc      1440
     gaatcgccga gccagcacta cgccctgacc gagaagcacg agggtgcggt gttcacgctt      1500
     gacggtcagg gctacaaggt gctgcgctgg gaggacacag cgcgcgggac ggccatcatc      1560
     gtggagaagc atctggcggc ggaccttttc acgcgggggc tgtattccac ccaggtccgc      1620
     ccggtgaaaa tgggcgagtg ggtgcggcgc gggccgctcg cctaccggca cggcgaagtc      1680
     gtggtgcagc gcatctatac cggctacacg gtgatgcggc aggtcttcga gcgcgtctgc      1740
     accggctgcg accgcgaccc ggccccctta gagcgggtgt gcgcgaactg cggcgggcgc      1800
     attcaggacc ggatgcagga ccagaaactc gctgagcagc tctacgacga ccccatcgag      1860
     ctgccgccct ttcgcacctc ggcgctggaa gtcggcattg acccggcccg caccgagcgg      1920
     cccaccgccg tggcgcacac gctcaagcac ctgctgatga aactcatccc cgagcgggtg      1980
     gcctgcgacg agggcgacct cgccggggcc tttcgcgagg gccacgacgc ttatttcttc      2040
     ctttacgacg actggcgcgg cgggctgggc gtctcgcgcc gcgcctttga gcagatggac      2100
     gacctgctgc ggcgggcgca cgtgctggcg accaaaacgt gctgcacgtc tccgcacggc      2160
     tgctttgagt gcatcgcggt cagccgctgt ttttcacccc tgctcccgag cggcgagcgg      2220
     cgccccaccg acaagcaggc gacggcgctg ttcttgcagg agctgctcgg cctgcaaccc      2280
     gcccccgccg aggccgaggt catccccgac gtggcgcccg ccctgcccgg cgactggccg      2340
     cagcaagcgc gcgaactgct ggacctgcac ggcctttcac ttcccgaggt cagcgcccgc      2400
     ctcggcattc ccagccgcga gttgcagcgg gcggtcaaca caacggcgcc cctgcgcctc      2460
     gcccacgcca aattcggcga aggcatcctg acccagggct cgggcagcgg cgacgcccgc      2520
     gaggtgctgg tgtactttcc gggccacggc tacaagcgcc tgctcgtcaa atacgccggg      2580
     ctgagcgtgg tgcaggggca ggcggcggga cgacggtag                             2619
//

If you have problems or comments...

PBIL Back to PBIL home page